Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6656
Gene name
LocationContig_349:7811..8515
Strand+
Gene length (bp)704
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13664 DUF4149 Domain of unknown function (DUF4149) 1.5E-24 15 124

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q06089|YP098_YEAST Uncharacterized mitochondrial outer membrane protein YPR098C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR098C PE=1 SV=2 13 176 1.0E-20

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 52 74 22
3 94 116 22
4 154 176 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6656
MACSAFCSVAPYHIISYGTLLGTSMFHSFINGPVMYKSIEKPAFSAAQKSLFPIYFSIQTAVPAILALTFPGNAL
AGVSPGISGLLDASSRWNSLLPITTMFLTGLVNLAVVLPATTKVMKERQGQSKRDGKNWYDQGPHSDEMLALNKK
FGMVHGISSLINLTTIISAVAYGFTLGSRM*
Coding >Hirsu2|6656
ATGGCGTGCTCGGCGTTCTGCTCTGTGGCTCCGTACCACATCATCTCCTACGGCACCCTACTAGGCACTTCGATG
TTCCACTCCTTCATCAACGGCCCGGTCATGTACAAGTCGATTGAGAAGCCGGCCTTCTCCGCCGCCCAGAAGAGC
CTGTTCCCCATCTATTTCAGCATACAAACGGCCGTCCCAGCAATCCTGGCGCTGACCTTTCCGGGAAACGCACTG
GCCGGCGTGTCGCCTGGCATTTCTGGGCTTCTGGATGCCTCGAGCCGGTGGAACTCGCTCCTCCCCATAACCACC
ATGTTTCTGACAGGCCTTGTCAACCTTGCTGTCGTCCTGCCGGCTACTACCAAGGTCATGAAGGAGCGCCAAGGT
CAAAGCAAGCGAGATGGGAAGAATTGGTACGACCAGGGTCCTCACTCCGATGAGATGCTTGCCCTGAATAAGAAG
TTCGGGATGGTGCACGGGATCTCCTCCCTCATCAACCTGACCACGATCATCTCAGCCGTTGCTTATGGCTTCACG
CTGGGATCCCGCATGTGA
Transcript >Hirsu2|6656
ATGGCGTGCTCGGCGTTCTGCTCTGTGGCTCCGTACCACATCATCTCCTACGGCACCCTACTAGGCACTTCGATG
TTCCACTCCTTCATCAACGGCCCGGTCATGTACAAGTCGATTGAGAAGCCGGCCTTCTCCGCCGCCCAGAAGAGC
CTGTTCCCCATCTATTTCAGCATACAAACGGCCGTCCCAGCAATCCTGGCGCTGACCTTTCCGGGAAACGCACTG
GCCGGCGTGTCGCCTGGCATTTCTGGGCTTCTGGATGCCTCGAGCCGGTGGAACTCGCTCCTCCCCATAACCACC
ATGTTTCTGACAGGCCTTGTCAACCTTGCTGTCGTCCTGCCGGCTACTACCAAGGTCATGAAGGAGCGCCAAGGT
CAAAGCAAGCGAGATGGGAAGAATTGGTACGACCAGGGTCCTCACTCCGATGAGATGCTTGCCCTGAATAAGAAG
TTCGGGATGGTGCACGGGATCTCCTCCCTCATCAACCTGACCACGATCATCTCAGCCGTTGCTTATGGCTTCACG
CTGGGATCCCGCATGTGA
Gene >Hirsu2|6656
ATGGCGTGCTCGGCGTTCTGCTCTGTGGCTCCGTACCACATCATCTCGTACGTGCATCAACTGTCAATTGTGGGA
GCGAATGGTCTGATGCTGACACTTGCATCAGCTACGGCACCCTACTAGGCACTTCGATGTTCCACGTGAGTGATG
TCCGCCCTCTCTTTTCCGTCGATGCTAATTCGACCTTTCCAGTCCTTCATCAACGGCCCGGTCATGTACAAGTCG
ATTGAGAAGCCGGCCTTCTCCGCCGCCCAGAAGAGCCTGTTCCCCATCTATTTCAGCATACAAACGGCCGTCCCA
GCAATCCTGGCGCTGACCTTTCCGGGAAACGCACTGGCCGGCGTGTCGCCTGGCATTTCTGGGCTTCTGGATGCC
TCGAGCCGGTGGAACTCGCTCCTCCCCATAACCACCATGTTTCTGACAGGCCTTGTCAACCTTGCTGTCGTCCTG
CCGGCTACTACCAAGGTCATGAAGGAGCGCCAAGGTCAAAGTAAAACAACTCGCTCAGCCGTACGGTTGATCAAA
GCTAACTGTAACCAGGCAAGCGAGATGGGAAGAATTGGTACGACCAGGGTCCTCACTCCGATGAGATGCTTGCCC
TGAATAAGAAGTTCGGGATGGTGCACGGGATCTCCTCCCTCATCAACCTGACCACGATCATCTCAGCCGTTGCTT
ATGGCTTCACGCTGGGATCCCGCATGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail