Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6652
Gene name
LocationContig_348:14579..15457
Strand+
Gene length (bp)878
Transcript length (bp)618
Coding sequence length (bp)618
Protein length (aa) 206

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01105 EMP24_GP25L emp24/gp25L/p24 family/GOLD 1.9E-45 24 200

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32803|EMP24_YEAST Endosomal protein P24B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP24 PE=1 SV=1 14 205 3.0E-56
sp|Q9P7I9|EMP24_SCHPO Endosomal protein P24B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=emp24 PE=3 SV=1 8 205 1.0E-51
sp|Q769F9|TMEDA_DICDI Transmembrane emp24 domain-containing protein A OS=Dictyostelium discoideum GN=empA PE=3 SV=1 34 205 2.0E-29
sp|A7SXK3|TMED_NEMVE Transmembrane emp24 domain-containing protein OS=Nematostella vectensis GN=v1g194562 PE=3 SV=1 6 205 2.0E-29
sp|O17528|TMED2_CAEEL Suppressor/enhancer of lin-12 protein 9 OS=Caenorhabditis elegans GN=sel-9 PE=1 SV=1 21 205 3.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32803|EMP24_YEAST Endosomal protein P24B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP24 PE=1 SV=1 14 205 3.0E-56
sp|Q9P7I9|EMP24_SCHPO Endosomal protein P24B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=emp24 PE=3 SV=1 8 205 1.0E-51
sp|Q769F9|TMEDA_DICDI Transmembrane emp24 domain-containing protein A OS=Dictyostelium discoideum GN=empA PE=3 SV=1 34 205 2.0E-29
sp|A7SXK3|TMED_NEMVE Transmembrane emp24 domain-containing protein OS=Nematostella vectensis GN=v1g194562 PE=3 SV=1 6 205 2.0E-29
sp|O17528|TMED2_CAEEL Suppressor/enhancer of lin-12 protein 9 OS=Caenorhabditis elegans GN=sel-9 PE=1 SV=1 21 205 3.0E-29
sp|P49020|TMED2_CRIGR Transmembrane emp24 domain-containing protein 2 (Fragment) OS=Cricetulus griseus GN=TMED2 PE=1 SV=1 21 205 1.0E-27
sp|Q63524|TMED2_RAT Transmembrane emp24 domain-containing protein 2 OS=Rattus norvegicus GN=Tmed2 PE=1 SV=1 22 205 4.0E-27
sp|Q15363|TMED2_HUMAN Transmembrane emp24 domain-containing protein 2 OS=Homo sapiens GN=TMED2 PE=1 SV=1 22 205 4.0E-27
sp|Q9R0Q3|TMED2_MOUSE Transmembrane emp24 domain-containing protein 2 OS=Mus musculus GN=Tmed2 PE=1 SV=1 22 205 4.0E-27
sp|Q28735|TMEDA_RABIT Transmembrane emp24 domain-containing protein 10 OS=Oryctolagus cuniculus GN=TMED10 PE=1 SV=1 23 205 4.0E-21
sp|Q5E971|TMEDA_BOVIN Transmembrane emp24 domain-containing protein 10 OS=Bos taurus GN=TMED10 PE=2 SV=1 23 205 9.0E-21
sp|P49755|TMEDA_HUMAN Transmembrane emp24 domain-containing protein 10 OS=Homo sapiens GN=TMED10 PE=1 SV=2 23 205 1.0E-20
sp|Q5RE32|TMEDA_PONAB Transmembrane emp24 domain-containing protein 10 OS=Pongo abelii GN=TMED10 PE=2 SV=1 23 205 2.0E-20
sp|Q54BN0|TMEDB_DICDI Transmembrane emp24 domain-containing protein B OS=Dictyostelium discoideum GN=empB PE=3 SV=1 21 202 2.0E-20
sp|O35587|TMEDA_MESAU Transmembrane protein Tmp21 OS=Mesocricetus auratus GN=TMED10 PE=1 SV=1 23 205 2.0E-20
sp|Q9D1D4|TMEDA_MOUSE Transmembrane emp24 domain-containing protein 10 OS=Mus musculus GN=Tmed10 PE=1 SV=1 25 205 2.0E-20
sp|Q63584|TMEDA_RAT Transmembrane emp24 domain-containing protein 10 OS=Rattus norvegicus GN=Tmed10 PE=1 SV=2 27 205 4.0E-20
sp|Q9LIL4|P24B3_ARATH Transmembrane emp24 domain-containing protein p24beta3 OS=Arabidopsis thaliana GN=At3g22845 PE=2 SV=1 31 199 1.0E-17
sp|Q9Y3B3|TMED7_HUMAN Transmembrane emp24 domain-containing protein 7 OS=Homo sapiens GN=TMED7 PE=1 SV=2 21 205 2.0E-17
sp|D3ZTX0|TMED7_RAT Transmembrane emp24 domain-containing protein 7 OS=Rattus norvegicus GN=Tmed7 PE=1 SV=1 28 205 4.0E-17
sp|Q5A302|TMEDA_CANAL Endoplasmic reticulum vesicle protein 25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERV25 PE=3 SV=1 8 205 2.0E-15
sp|P38819|ERP5_YEAST Protein ERP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP5 PE=1 SV=1 19 205 7.0E-15
sp|Q6BTC2|TMEDA_DEBHA Endoplasmic reticulum vesicle protein 25 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERV25 PE=3 SV=2 35 205 8.0E-15
sp|Q90515|TMEDA_TAKRU Transmembrane emp24 domain-containing protein 10 OS=Takifugu rubripes GN=tmed10 PE=3 SV=1 1 205 3.0E-14
sp|B4JYU5|TMEDA_DROGR Transmembrane emp24 domain-containing protein bai OS=Drosophila grimshawi GN=bai PE=3 SV=2 8 205 4.0E-14
sp|Q28BQ6|TMED1_XENTR Transmembrane emp24 domain-containing protein 1 OS=Xenopus tropicalis GN=tmed1 PE=2 SV=1 10 205 7.0E-14
sp|Q5B5L5|TMEDA_EMENI Endoplasmic reticulum vesicle protein 25 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=erv25 PE=3 SV=1 6 205 1.0E-13
sp|Q12450|ERP4_YEAST Protein ERP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP4 PE=1 SV=1 1 199 2.0E-13
sp|Q6IDL4|P24D3_ARATH Transmembrane emp24 domain-containing protein p24delta3 OS=Arabidopsis thaliana GN=At1g09580 PE=1 SV=1 65 205 9.0E-13
sp|B4JG34|TMEDE_DROGR Transmembrane emp24 domain-containing protein eca OS=Drosophila grimshawi GN=eca PE=3 SV=1 11 205 1.0E-12
sp|Q6AY25|TMED3_RAT Transmembrane emp24 domain-containing protein 3 OS=Rattus norvegicus GN=Tmed3 PE=1 SV=1 28 205 1.0E-12
sp|O13770|YE98_SCHPO Uncharacterized membrane protein C17A5.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A5.08 PE=3 SV=1 1 200 2.0E-12
sp|B4KB41|TMEDE_DROMO Transmembrane emp24 domain-containing protein eca OS=Drosophila mojavensis GN=eca PE=3 SV=1 11 205 2.0E-12
sp|Q78IS1|TMED3_MOUSE Transmembrane emp24 domain-containing protein 3 OS=Mus musculus GN=Tmed3 PE=1 SV=1 28 205 2.0E-12
sp|B4K4G5|TMEDA_DROMO Transmembrane emp24 domain-containing protein bai OS=Drosophila mojavensis GN=bai PE=3 SV=1 8 205 2.0E-12
sp|Q9Y3Q3|TMED3_HUMAN Transmembrane emp24 domain-containing protein 3 OS=Homo sapiens GN=TMED3 PE=1 SV=1 28 205 5.0E-12
sp|Q4WQL0|TMEDA_ASPFU Endoplasmic reticulum vesicle protein 25 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=erv25 PE=3 SV=1 13 199 5.0E-12
sp|Q9HEK4|TMEDA_NEUCR Endoplasmic reticulum vesicle protein 25 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erv-1 PE=3 SV=3 18 205 5.0E-12
sp|B4QWH9|TMEDE_DROSI Transmembrane emp24 domain-containing protein eca OS=Drosophila simulans GN=eca PE=3 SV=1 11 205 6.0E-12
sp|Q9I7K5|TMEDE_DROME Transmembrane emp24 domain-containing protein eca OS=Drosophila melanogaster GN=eca PE=2 SV=2 11 205 6.0E-12
sp|B4HJV5|TMEDE_DROSE Transmembrane emp24 domain-containing protein eca OS=Drosophila sechellia GN=eca PE=3 SV=1 11 205 7.0E-12
sp|B4LYB8|TMEDE_DROVI Transmembrane emp24 domain-containing protein eca OS=Drosophila virilis GN=eca PE=3 SV=1 11 205 8.0E-12
sp|B4NIY1|TMEDA_DROWI Transmembrane emp24 domain-containing protein bai OS=Drosophila willistoni GN=bai PE=3 SV=1 8 205 1.0E-11
sp|Q3V009|TMED1_MOUSE Transmembrane emp24 domain-containing protein 1 OS=Mus musculus GN=Tmed1 PE=1 SV=1 28 205 1.0E-11
sp|B4PVC6|TMEDE_DROYA Transmembrane emp24 domain-containing protein eca OS=Drosophila yakuba GN=eca PE=3 SV=1 11 205 1.0E-11
sp|B4MGF8|TMEDA_DROVI Transmembrane emp24 domain-containing protein bai OS=Drosophila virilis GN=bai PE=3 SV=1 27 205 1.0E-11
sp|B3NZM5|TMEDE_DROER Transmembrane emp24 domain-containing protein eca OS=Drosophila erecta GN=eca PE=3 SV=1 11 205 1.0E-11
sp|B4NKL0|TMEDE_DROWI Transmembrane emp24 domain-containing protein eca OS=Drosophila willistoni GN=eca PE=3 SV=1 11 205 2.0E-11
sp|Q4HY20|TMEDA_GIBZE Endoplasmic reticulum vesicle protein 25 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ERV25 PE=3 SV=1 22 205 2.0E-11
sp|Q8SXY6|TMEDA_DROME Transmembrane emp24 domain-containing protein bai OS=Drosophila melanogaster GN=bai PE=2 SV=1 12 205 2.0E-11
sp|B3MTS8|TMEDE_DROAN Transmembrane emp24 domain-containing protein eca OS=Drosophila ananassae GN=eca PE=3 SV=1 27 205 3.0E-11
sp|B4PUZ3|TMEDA_DROYA Transmembrane emp24 domain-containing protein bai OS=Drosophila yakuba GN=bai PE=3 SV=1 12 205 3.0E-11
sp|B3P6T8|TMEDA_DROER Transmembrane emp24 domain-containing protein bai OS=Drosophila erecta GN=bai PE=3 SV=1 12 205 3.0E-11
sp|Q6AXN3|TMED5_RAT Transmembrane emp24 domain-containing protein 5 OS=Rattus norvegicus GN=Tmed5 PE=2 SV=1 1 203 4.0E-11
sp|Q295B2|TMEDE_DROPS Transmembrane emp24 domain-containing protein eca OS=Drosophila pseudoobscura pseudoobscura GN=eca PE=3 SV=1 27 205 5.0E-11
sp|B4GMC3|TMEDE_DROPE Transmembrane emp24 domain-containing protein eca OS=Drosophila persimilis GN=eca PE=3 SV=1 27 205 6.0E-11
sp|B3LVB0|TMEDA_DROAN Transmembrane emp24 domain-containing protein bai OS=Drosophila ananassae GN=bai PE=3 SV=1 28 205 7.0E-11
sp|A0AQ71|TMEDA_DROSI Transmembrane emp24 domain-containing protein bai OS=Drosophila simulans GN=bai PE=3 SV=1 12 205 8.0E-11
sp|Q9CXE7|TMED5_MOUSE Transmembrane emp24 domain-containing protein 5 OS=Mus musculus GN=Tmed5 PE=1 SV=1 12 203 1.0E-10
sp|Q05359|ERP1_YEAST Protein ERP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP1 PE=1 SV=1 4 205 2.0E-10
sp|Q5BK85|TMED1_RAT Transmembrane emp24 domain-containing protein 1 OS=Rattus norvegicus GN=Tmed1 PE=2 SV=1 28 202 2.0E-10
sp|B4GE47|TMEDA_DROPE Transmembrane emp24 domain-containing protein bai OS=Drosophila persimilis GN=bai PE=3 SV=1 27 205 2.0E-10
sp|Q9BVK6|TMED9_HUMAN Transmembrane emp24 domain-containing protein 9 OS=Homo sapiens GN=TMED9 PE=1 SV=2 2 205 2.0E-10
sp|Q8RWM6|P24D5_ARATH Transmembrane emp24 domain-containing protein p24delta5 OS=Arabidopsis thaliana GN=At1g21900 PE=1 SV=1 30 205 4.0E-10
sp|Q5R7E6|TMED1_PONAB Transmembrane emp24 domain-containing protein 1 OS=Pongo abelii GN=TMED1 PE=2 SV=1 28 205 5.0E-10
sp|Q13445|TMED1_HUMAN Transmembrane emp24 domain-containing protein 1 OS=Homo sapiens GN=TMED1 PE=1 SV=1 28 205 5.0E-10
sp|P53198|ERP6_YEAST Protein ERP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP6 PE=1 SV=1 78 205 5.0E-10
sp|Q99KF1|TMED9_MOUSE Transmembrane emp24 domain-containing protein 9 OS=Mus musculus GN=Tmed9 PE=1 SV=2 21 205 9.0E-10
sp|Q2TBK5|TMED1_BOVIN Transmembrane emp24 domain-containing protein 1 OS=Bos taurus GN=TMED1 PE=2 SV=1 28 205 9.0E-10
sp|Q8R1V4|TMED4_MOUSE Transmembrane emp24 domain-containing protein 4 OS=Mus musculus GN=Tmed4 PE=1 SV=1 11 205 2.0E-09
sp|Q3T133|TMED9_BOVIN Transmembrane emp24 domain-containing protein 9 OS=Bos taurus GN=TMED9 PE=1 SV=1 27 205 2.0E-09
sp|Q7Z7H5|TMED4_HUMAN Transmembrane emp24 domain-containing protein 4 OS=Homo sapiens GN=TMED4 PE=1 SV=1 27 205 3.0E-09
sp|Q5I0E7|TMED9_RAT Transmembrane emp24 domain-containing protein 9 OS=Rattus norvegicus GN=Tmed9 PE=1 SV=1 27 205 3.0E-09
sp|P54837|TMEDA_YEAST Endoplasmic reticulum vesicle protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV25 PE=1 SV=1 89 205 6.0E-09
sp|Q5R809|TMED5_PONAB Transmembrane emp24 domain-containing protein 5 OS=Pongo abelii GN=TMED5 PE=2 SV=1 12 203 7.0E-09
sp|Q9FVU0|P24D4_ARATH Transmembrane emp24 domain-containing protein p24delta4 OS=Arabidopsis thaliana GN=CYB PE=1 SV=1 65 205 8.0E-09
sp|Q9LQY3|P24D9_ARATH Transmembrane emp24 domain-containing protein p24delta9 OS=Arabidopsis thaliana GN=At1g26690 PE=2 SV=1 9 205 1.0E-08
sp|Q9Y3A6|TMED5_HUMAN Transmembrane emp24 domain-containing protein 5 OS=Homo sapiens GN=TMED5 PE=1 SV=1 12 203 1.0E-08
sp|Q6FRZ3|TMEDA_CANGA Endoplasmic reticulum vesicle protein 25 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERV25 PE=3 SV=2 133 205 1.0E-08
sp|Q2KJ84|TMED5_BOVIN Transmembrane emp24 domain-containing protein 5 OS=Bos taurus GN=TMED5 PE=2 SV=1 20 203 3.0E-08
sp|Q9S7M9|P24B2_ARATH Transmembrane emp24 domain-containing protein p24beta2 OS=Arabidopsis thaliana GN=At3g07680 PE=1 SV=1 34 202 3.0E-08
sp|Q6CWW7|TMEDA_KLULA Endoplasmic reticulum vesicle protein 25 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERV25 PE=3 SV=1 90 205 1.0E-07
sp|P39704|ERP2_YEAST Protein ERP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERP2 PE=1 SV=1 26 175 1.0E-07
sp|P0CN73|TMEDA_CRYNB Endoplasmic reticulum vesicle protein 25 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ERV25 PE=3 SV=1 89 205 2.0E-07
sp|P0CN72|TMEDA_CRYNJ Endoplasmic reticulum vesicle protein 25 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ERV25 PE=3 SV=1 101 205 2.0E-07
sp|O81045|P24D8_ARATH Transmembrane emp24 domain-containing protein p24delta8 OS=Arabidopsis thaliana GN=At2g03290 PE=1 SV=1 28 205 2.0E-07
sp|F4J4Y0|P24D6_ARATH Transmembrane emp24 domain-containing protein p24delta6 OS=Arabidopsis thaliana GN=At3g10780 PE=1 SV=1 35 205 3.0E-07
sp|Q6C503|TMEDA_YARLI Endoplasmic reticulum vesicle protein 25 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERV25 PE=3 SV=1 89 205 5.0E-07
sp|Q9D2R4|TMD11_MOUSE Transmembrane emp24 domain-containing protein 11 OS=Mus musculus GN=Tmed11 PE=1 SV=1 17 205 5.0E-07
sp|Q759T8|TMEDA_ASHGO Endoplasmic reticulum vesicle protein 25 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERV25 PE=3 SV=1 89 205 9.0E-07
sp|P27869|TMD11_CANLF Transmembrane emp24 domain-containing protein 11 OS=Canis lupus familiaris GN=TMED11 PE=1 SV=1 10 205 1.0E-06
sp|O14324|YB79_SCHPO Uncharacterized membrane protein C16E9.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16E9.09c PE=3 SV=1 90 205 1.0E-06
sp|O13946|TMEDA_SCHPO Endoplasmic reticulum vesicle protein 25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv25 PE=3 SV=1 132 205 3.0E-06
sp|Q8VY92|P24DA_ARATH Transmembrane emp24 domain-containing protein p24delta10 OS=Arabidopsis thaliana GN=At1g69460 PE=1 SV=1 23 205 4.0E-06
sp|Q8GYG1|P24D7_ARATH Transmembrane emp24 domain-containing protein p24delta7 OS=Arabidopsis thaliana GN=At1g14010 PE=2 SV=1 28 205 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 173 195 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6652
MRPLTASRSLLAAAAVAFQLASAHNVHLQSNAVECFHENLHKEDTMTVTFQVGDREFGGAGNLDIDFTIQNPLGQ
FEANEKAVSTGDHSFTAKHDGKYKYCFGNQYWGANSKEVSFNVHGIVYVSESEMPSDPIESEVRHLSELLAQVRD
EQQYIIVRERTHRNTAESTNARVKWWNLFVIGVVIGECLFQIWWLRRFFEVKRVV*
Coding >Hirsu2|6652
ATGCGTCCGCTGACGGCCTCGAGGTCGCTCCTCGCCGCCGCGGCCGTGGCCTTCCAGCTGGCCTCGGCGCACAAC
GTGCACCTGCAGTCCAACGCCGTCGAGTGCTTCCATGAGAACCTGCACAAGGAGGACACCATGACCGTCACCTTC
CAGGTCGGCGACCGCGAGTTCGGCGGCGCCGGGAACCTCGACATCGACTTCACGATACAAAACCCCCTGGGCCAG
TTCGAGGCCAACGAAAAGGCCGTCTCGACCGGCGACCACTCCTTCACGGCCAAGCACGACGGCAAGTACAAGTAC
TGCTTCGGCAACCAGTACTGGGGCGCCAACAGCAAGGAGGTCTCCTTCAACGTCCACGGCATCGTCTACGTCAGC
GAGTCCGAGATGCCTTCGGACCCCATCGAATCTGAGGTCCGCCACCTGTCCGAACTCCTCGCCCAGGTCCGGGAC
GAGCAGCAATACATCATCGTCCGCGAGCGCACCCACCGTAACACGGCGGAGAGCACCAACGCCCGCGTCAAGTGG
TGGAACCTGTTCGTCATCGGCGTCGTCATCGGCGAATGCCTCTTCCAGATTTGGTGGCTGCGGCGCTTCTTCGAG
GTCAAACGCGTCGTTTAG
Transcript >Hirsu2|6652
ATGCGTCCGCTGACGGCCTCGAGGTCGCTCCTCGCCGCCGCGGCCGTGGCCTTCCAGCTGGCCTCGGCGCACAAC
GTGCACCTGCAGTCCAACGCCGTCGAGTGCTTCCATGAGAACCTGCACAAGGAGGACACCATGACCGTCACCTTC
CAGGTCGGCGACCGCGAGTTCGGCGGCGCCGGGAACCTCGACATCGACTTCACGATACAAAACCCCCTGGGCCAG
TTCGAGGCCAACGAAAAGGCCGTCTCGACCGGCGACCACTCCTTCACGGCCAAGCACGACGGCAAGTACAAGTAC
TGCTTCGGCAACCAGTACTGGGGCGCCAACAGCAAGGAGGTCTCCTTCAACGTCCACGGCATCGTCTACGTCAGC
GAGTCCGAGATGCCTTCGGACCCCATCGAATCTGAGGTCCGCCACCTGTCCGAACTCCTCGCCCAGGTCCGGGAC
GAGCAGCAATACATCATCGTCCGCGAGCGCACCCACCGTAACACGGCGGAGAGCACCAACGCCCGCGTCAAGTGG
TGGAACCTGTTCGTCATCGGCGTCGTCATCGGCGAATGCCTCTTCCAGATTTGGTGGCTGCGGCGCTTCTTCGAG
GTCAAACGCGTCGTTTAG
Gene >Hirsu2|6652
ATGCGTCCGCTGACGGCCTCGAGGTCGCTCCTCGCCGCCGCGGCCGTGGCCTTCCAGCTGGCCTCGGCGCACAAC
GTGCACCTGCAGTCCAACGCCGTCGAGTGCTTCCATGAGAACCTGCACAAGGAGGACACCATGACCGTCACCTTC
CAGGTCGGCGACCGCGAGTTCGGCGGCGCCGGGAACCTCGACATCGACTTCACGGTACGGGCCCCCTTCTCCCTC
CCTCCCCGCGGAACCCCGTCAGGCCCGAATTGGACGGCGCAGGGGCGCGGCCGATGGAGAGAGGCCTGCCGAGTC
CCTCGCCGCGTGATCGAGATGCCGCGAGACTGACGCCTCGCGGCCGGAGCGTCGTCGGACAGATACAAAACCCCC
TGGGCCAGTTCGAGGCCAACGAAAAGGCCGTCTCGACCGGCGACCACTCCTTCACGGCCAAGCACGACGGCAAGT
ACAAGTACTGCTTCGGCAACCAGTACTGGGGCGCCAACAGCAAGGAGGTCTCCTTCAACGTCCACGGCATCGTCT
ACGTCAGCGAGTCCGAGATGCCTTCGGACCCCATCGAATCTGAGGGTGCGTCCAACTACTGCTTGACCCCTCCCC
CTATCTTTCAGCACAGCCCGCAACGGCCTGTGACGGGTCTCGCACGATACTGACCTGCCCGCCGCACCGCAGTCC
GCCACCTGTCCGAACTCCTCGCCCAGGTCCGGGACGAGCAGCAATACATCATCGTCCGCGAGCGCACCCACCGTA
ACACGGCGGAGAGCACCAACGCCCGCGTCAAGTGGTGGAACCTGTTCGTCATCGGCGTCGTCATCGGCGAATGCC
TCTTCCAGATTTGGTGGCTGCGGCGCTTCTTCGAGGTCAAACGCGTCGTTTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail