Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6650
Gene name
LocationContig_348:7940..10316
Strand+
Gene length (bp)2376
Transcript length (bp)2376
Coding sequence length (bp)2376
Protein length (aa) 792

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07724 AAA_2 AAA domain (Cdc48 subfamily) 5.9E-43 511 683
PF17871 AAA_lid_9 AAA lid domain 2.2E-35 255 357
PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein 4.0E-24 690 769
PF00004 AAA ATPase family associated with various cellular activities (AAA) 7.2E-11 117 250
PF00004 AAA ATPase family associated with various cellular activities (AAA) 1.4E-05 518 611
PF07728 AAA_5 AAA domain (dynein-related subfamily) 2.7E-08 516 633

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74402|HSP78_SCHPO Heat shock protein 78, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp78 PE=3 SV=1 33 788 0.0E+00
sp|P33416|HSP78_YEAST Heat shock protein 78, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP78 PE=1 SV=2 63 774 0.0E+00
sp|Q96UX5|HSP78_CANAL Heat shock protein 78, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSP78 PE=3 SV=1 70 774 0.0E+00
sp|Q7CU92|CLPB_AGRFC Chaperone protein ClpB OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=clpB PE=3 SV=2 74 779 0.0E+00
sp|Q8YJ91|CLPB_BRUME Chaperone protein ClpB OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=clpB PE=3 SV=2 74 785 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74402|HSP78_SCHPO Heat shock protein 78, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp78 PE=3 SV=1 33 788 0.0E+00
sp|P33416|HSP78_YEAST Heat shock protein 78, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP78 PE=1 SV=2 63 774 0.0E+00
sp|Q96UX5|HSP78_CANAL Heat shock protein 78, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSP78 PE=3 SV=1 70 774 0.0E+00
sp|Q7CU92|CLPB_AGRFC Chaperone protein ClpB OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=clpB PE=3 SV=2 74 779 0.0E+00
sp|Q8YJ91|CLPB_BRUME Chaperone protein ClpB OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=clpB PE=3 SV=2 74 785 0.0E+00
sp|Q6N1H2|CLPB_RHOPA Chaperone protein ClpB OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=clpB PE=3 SV=1 74 775 0.0E+00
sp|Q9A9T4|CLPB_CAUCR Chaperone protein ClpB OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=clpB PE=3 SV=1 74 775 0.0E+00
sp|Q89UL2|CLPB_BRADU Chaperone protein ClpB OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=clpB PE=3 SV=1 74 788 0.0E+00
sp|Q1RGR1|CLPB_RICBR Chaperone protein ClpB OS=Rickettsia bellii (strain RML369-C) GN=clpB PE=3 SV=1 74 773 0.0E+00
sp|Q7CEG6|CLPB_BRUSU Chaperone protein ClpB OS=Brucella suis biovar 1 (strain 1330) GN=clpB PE=2 SV=1 74 785 0.0E+00
sp|Q92MK7|CLPB_RHIME Chaperone protein ClpB OS=Rhizobium meliloti (strain 1021) GN=clpB PE=3 SV=1 74 780 0.0E+00
sp|Q98G96|CLPB_RHILO Chaperone protein ClpB OS=Rhizobium loti (strain MAFF303099) GN=clpB PE=3 SV=1 74 780 0.0E+00
sp|Q92JK8|CLPB_RICCN Chaperone protein ClpB OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=clpB PE=3 SV=1 74 774 0.0E+00
sp|Q8P6A0|CLPB_XANCP Chaperone protein ClpB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=clpB PE=3 SV=1 59 775 0.0E+00
sp|P44403|CLPB_HAEIN Chaperone protein ClpB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=clpB PE=3 SV=1 56 770 0.0E+00
sp|Q4UN57|CLPB_RICFE Chaperone protein ClpB OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=clpB PE=3 SV=2 74 770 0.0E+00
sp|Q9ZEA9|CLPB_RICPR Chaperone protein ClpB OS=Rickettsia prowazekii (strain Madrid E) GN=clpB PE=3 SV=1 44 771 0.0E+00
sp|Q9CKC0|CLPB_PASMU Chaperone protein ClpB OS=Pasteurella multocida (strain Pm70) GN=clpB PE=3 SV=1 59 775 0.0E+00
sp|Q8YM56|CLPB2_NOSS1 Chaperone protein ClpB 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=clpB2 PE=3 SV=2 74 784 0.0E+00
sp|Q8PHQ4|CLPB_XANAC Chaperone protein ClpB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=clpB PE=3 SV=2 59 776 0.0E+00
sp|Q87AX8|CLPB_XYLFT Chaperone protein ClpB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=clpB PE=3 SV=1 59 776 0.0E+00
sp|Q74X11|CLPB_YERPE Chaperone protein ClpB OS=Yersinia pestis GN=clpB PE=3 SV=2 59 775 0.0E+00
sp|Q68XR2|CLPB_RICTY Chaperone protein ClpB OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=clpB PE=3 SV=1 44 770 0.0E+00
sp|Q9RA63|CLPB_THET8 Chaperone protein ClpB OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=clpB PE=1 SV=2 6 776 0.0E+00
sp|Q7NFE9|CLPB_GLOVI Chaperone protein ClpB OS=Gloeobacter violaceus (strain PCC 7421) GN=clpB PE=3 SV=1 74 765 0.0E+00
sp|Q72IK9|CLPB_THET2 Chaperone protein ClpB OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=clpB PE=3 SV=1 6 776 0.0E+00
sp|Q7CQ01|CLPB_SALTY Chaperone protein ClpB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=clpB PE=3 SV=1 59 774 0.0E+00
sp|Q7AMH5|CLPB_SALTI Chaperone protein ClpB OS=Salmonella typhi GN=clpB PE=3 SV=1 59 774 0.0E+00
sp|P74361|CLPB2_SYNY3 Chaperone protein ClpB 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=clpB2 PE=3 SV=1 60 767 0.0E+00
sp|Q83F55|CLPB_COXBU Chaperone protein ClpB OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=clpB PE=3 SV=1 70 765 0.0E+00
sp|Q9PGC1|CLPB_XYLFA Chaperone protein ClpB OS=Xylella fastidiosa (strain 9a5c) GN=clpB PE=3 SV=1 59 776 0.0E+00
sp|P63284|CLPB_ECOLI Chaperone protein ClpB OS=Escherichia coli (strain K12) GN=clpB PE=1 SV=1 59 774 0.0E+00
sp|P63286|CLPB_ECOL6 Chaperone protein ClpB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=clpB PE=3 SV=1 59 774 0.0E+00
sp|P63285|CLPB_ECO57 Chaperone protein ClpB OS=Escherichia coli O157:H7 GN=clpB PE=3 SV=1 59 774 0.0E+00
sp|Q7V8B1|CLPB_PROMM Chaperone protein ClpB OS=Prochlorococcus marinus (strain MIT 9313) GN=clpB PE=3 SV=1 74 772 0.0E+00
sp|Q7X2S8|CLPB_MEIRU Chaperone protein ClpB OS=Meiothermus ruber GN=clpB PE=3 SV=1 74 779 0.0E+00
sp|Q7WSY8|CLPB_PROFC Chaperone protein ClpB OS=Propionibacterium freudenreichii subsp. shermanii (strain ATCC 9614 / CIP 103027 / CIRM-BIA1) GN=clpB PE=2 SV=2 74 786 0.0E+00
sp|Q73IE4|CLPB_WOLPM Chaperone protein ClpB OS=Wolbachia pipientis wMel GN=clpB PE=3 SV=1 68 762 0.0E+00
sp|Q6LMY0|CLPB_PHOPR Chaperone protein ClpB OS=Photobacterium profundum GN=clpB PE=3 SV=2 59 774 0.0E+00
sp|P53532|CLPB_CORGL Chaperone protein ClpB OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=clpB PE=2 SV=1 74 781 0.0E+00
sp|Q8EBE6|CLPB_SHEON Chaperone protein ClpB OS=Shewanella oneidensis (strain MR-1) GN=clpB PE=3 SV=1 59 775 0.0E+00
sp|Q7UBW5|CLPB_SHIFL Chaperone protein ClpB OS=Shigella flexneri GN=clpB PE=3 SV=2 59 774 0.0E+00
sp|Q9RVI3|CLPB_DEIRA Chaperone protein ClpB OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=clpB PE=3 SV=2 74 776 0.0E+00
sp|Q7U637|CLPB1_SYNPX Chaperone protein ClpB 1 OS=Synechococcus sp. (strain WH8102) GN=clpB1 PE=3 SV=2 74 777 0.0E+00
sp|Q8XZR0|CLPB_RALSO Chaperone protein ClpB OS=Ralstonia solanacearum (strain GMI1000) GN=clpB PE=3 SV=1 65 782 0.0E+00
sp|Q7VNH1|CLPB_HAEDU Chaperone protein ClpB OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=clpB PE=3 SV=1 44 762 0.0E+00
sp|Q8FM94|CLPB_COREF Chaperone protein ClpB OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=clpB PE=3 SV=1 74 781 0.0E+00
sp|Q7N788|CLPB_PHOLL Chaperone protein ClpB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=clpB PE=3 SV=1 59 774 0.0E+00
sp|Q87S63|CLPB_VIBPA Chaperone protein ClpB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=clpB PE=3 SV=1 60 762 0.0E+00
sp|Q73K92|CLPB_TREDE Chaperone protein ClpB OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=clpB PE=3 SV=1 74 765 0.0E+00
sp|O87444|CLPB_LEPBY Chaperone protein ClpB OS=Leptolyngbya boryana GN=clpB PE=2 SV=2 74 772 0.0E+00
sp|P53533|CLPB1_SYNE7 Chaperone protein ClpB 1 OS=Synechococcus elongatus (strain PCC 7942) GN=clpB1 PE=2 SV=3 74 774 0.0E+00
sp|O83110|CLPB_TREPA Chaperone protein ClpB OS=Treponema pallidum (strain Nichols) GN=clpB PE=3 SV=1 74 765 0.0E+00
sp|Q9KU18|CLPB_VIBCH Chaperone protein ClpB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=clpB PE=3 SV=1 60 776 0.0E+00
sp|Q82SD8|CLPB_NITEU Chaperone protein ClpB OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=clpB PE=3 SV=1 72 775 0.0E+00
sp|Q8G4X4|CLPB_BIFLO Chaperone protein ClpB OS=Bifidobacterium longum (strain NCC 2705) GN=clpB PE=3 SV=1 74 781 0.0E+00
sp|Q9HVN5|CLPB_PSEAE Chaperone protein ClpB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=clpB PE=3 SV=1 25 772 0.0E+00
sp|Q73T66|CLPB_MYCPA Chaperone protein ClpB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=clpB PE=3 SV=1 74 779 0.0E+00
sp|Q88VX7|CLPB_LACPL Chaperone protein ClpB OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=clpB PE=3 SV=1 35 762 0.0E+00
sp|Q889C2|CLPB_PSESM Chaperone protein ClpB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=clpB PE=3 SV=1 70 774 0.0E+00
sp|Q6MIV0|CLPB_BDEBA Chaperone protein ClpB OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=clpB PE=3 SV=1 75 771 0.0E+00
sp|Q6NF05|CLPB_CORDI Chaperone protein ClpB OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=clpB PE=3 SV=1 74 779 0.0E+00
sp|Q929G7|CLPB_LISIN Chaperone protein ClpB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=clpB PE=3 SV=1 59 774 0.0E+00
sp|Q7MNK1|CLPB_VIBVY Chaperone protein ClpB OS=Vibrio vulnificus (strain YJ016) GN=clpB PE=3 SV=1 60 760 0.0E+00
sp|Q8RHQ8|CLPB_FUSNN Chaperone protein ClpB OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=clpB PE=3 SV=2 74 758 0.0E+00
sp|Q7NWN7|CLPB_CHRVO Chaperone protein ClpB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=clpB PE=3 SV=1 60 775 0.0E+00
sp|Q8DEV2|CLPB_VIBVU Chaperone protein ClpB OS=Vibrio vulnificus (strain CMCP6) GN=clpB PE=3 SV=1 60 760 0.0E+00
sp|Q8CJV9|CLPB_STRCO Chaperone protein ClpB OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=clpB PE=3 SV=1 74 788 0.0E+00
sp|Q88Q71|CLPB_PSEPK Chaperone protein ClpB OS=Pseudomonas putida (strain KT2440) GN=clpB PE=3 SV=1 44 772 0.0E+00
sp|Q8DJ40|CLPB1_THEEB Chaperone protein ClpB 1 OS=Thermosynechococcus elongatus (strain BP-1) GN=clpB1 PE=3 SV=1 74 760 0.0E+00
sp|Q9JTP9|CLPB_NEIMA Chaperone protein ClpB OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=clpB PE=3 SV=1 59 779 0.0E+00
sp|P9WPD1|CLPB_MYCTU Chaperone protein ClpB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=clpB PE=1 SV=1 74 779 0.0E+00
sp|P9WPD0|CLPB_MYCTO Chaperone protein ClpB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=clpB PE=3 SV=1 74 779 0.0E+00
sp|P63287|CLPB_MYCBO Chaperone protein ClpB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=clpB PE=3 SV=1 74 779 0.0E+00
sp|Q74FF1|CLPB_GEOSL Chaperone protein ClpB OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=clpB PE=3 SV=1 74 779 0.0E+00
sp|Q9JYQ8|CLPB_NEIMB Chaperone protein ClpB OS=Neisseria meningitidis serogroup B (strain MC58) GN=clpB PE=3 SV=1 59 779 0.0E+00
sp|Q72AW6|CLPB_DESVH Chaperone protein ClpB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=clpB PE=3 SV=1 60 774 0.0E+00
sp|Q71XF9|CLPB_LISMF Chaperone protein ClpB OS=Listeria monocytogenes serotype 4b (strain F2365) GN=clpB PE=3 SV=1 59 774 0.0E+00
sp|Q898C7|CLPB_CLOTE Chaperone protein ClpB OS=Clostridium tetani (strain Massachusetts / E88) GN=clpB PE=3 SV=1 74 773 0.0E+00
sp|Q8Y570|CLPB_LISMO Chaperone protein ClpB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=clpB PE=1 SV=1 59 774 0.0E+00
sp|G2K265|CLPB_LISM4 Chaperone protein ClpB OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=clpB PE=2 SV=1 59 774 0.0E+00
sp|Q8VYJ7|CLPB4_ARATH Chaperone protein ClpB4, mitochondrial OS=Arabidopsis thaliana GN=CLPB4 PE=2 SV=1 74 760 0.0E+00
sp|Q9CFF3|CLPB_LACLA Chaperone protein ClpB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=clpB PE=3 SV=1 59 762 0.0E+00
sp|Q831Y7|CLPB_ENTFA Chaperone protein ClpB OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=clpB PE=3 SV=1 59 762 0.0E+00
sp|Q826F2|CLPB2_STRAW Chaperone protein ClpB 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=clpB2 PE=3 SV=1 74 772 0.0E+00
sp|Q7VBL0|CLPB_PROMA Chaperone protein ClpB OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=clpB PE=3 SV=1 74 761 0.0E+00
sp|Q75GT3|CLPB2_ORYSJ Chaperone protein ClpB2, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPB2 PE=2 SV=1 74 763 0.0E+00
sp|Q72QU2|CLPB_LEPIC Chaperone protein ClpB OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=clpB PE=3 SV=1 74 775 0.0E+00
sp|Q8F509|CLPB_LEPIN Chaperone protein ClpB OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=clpB PE=3 SV=1 74 775 0.0E+00
sp|Q9LF37|CLPB3_ARATH Chaperone protein ClpB3, chloroplastic OS=Arabidopsis thaliana GN=CLPB3 PE=2 SV=1 74 763 0.0E+00
sp|Q97KG0|CLPB_CLOAB Chaperone protein ClpB OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=clpB PE=3 SV=1 74 774 0.0E+00
sp|O68185|CLPB_LACLM Chaperone protein ClpB OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=clpB PE=2 SV=3 59 785 0.0E+00
sp|Q8CPT5|CLPB_STAES Chaperone protein ClpB OS=Staphylococcus epidermidis (strain ATCC 12228) GN=clpB PE=3 SV=1 59 788 0.0E+00
sp|Q5HQI5|CLPB_STAEQ Chaperone protein ClpB OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=clpB PE=3 SV=1 59 788 0.0E+00
sp|Q8XKG8|CLPB_CLOPE Chaperone protein ClpB OS=Clostridium perfringens (strain 13 / Type A) GN=clpB PE=3 SV=1 74 782 0.0E+00
sp|P17422|CLPB_DICNO Chaperone protein ClpB OS=Dichelobacter nodosus GN=clpB PE=3 SV=2 70 761 0.0E+00
sp|Q82EU9|CLPB1_STRAW Chaperone protein ClpB 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=clpB1 PE=3 SV=1 74 788 0.0E+00
sp|Q89YY3|CLPB_BACTN Chaperone protein ClpB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=clpB PE=3 SV=1 74 779 0.0E+00
sp|Q9Z6E4|CLPB_STRAL Chaperone protein ClpB OS=Streptomyces albus G GN=clpB PE=2 SV=1 74 775 0.0E+00
sp|Q7UM33|CLPB_RHOBA Chaperone protein ClpB OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=clpB PE=3 SV=2 27 770 0.0E+00
sp|Q6GIB2|CLPB_STAAR Chaperone protein ClpB OS=Staphylococcus aureus (strain MRSA252) GN=clpB PE=3 SV=1 47 777 0.0E+00
sp|Q6GAV1|CLPB_STAAS Chaperone protein ClpB OS=Staphylococcus aureus (strain MSSA476) GN=clpB PE=3 SV=1 47 777 0.0E+00
sp|Q5HHB0|CLPB_STAAC Chaperone protein ClpB OS=Staphylococcus aureus (strain COL) GN=clpB PE=3 SV=1 47 777 0.0E+00
sp|Q8NXE7|CLPB_STAAW Chaperone protein ClpB OS=Staphylococcus aureus (strain MW2) GN=clpB PE=3 SV=1 47 777 0.0E+00
sp|Q7A6G6|CLPB_STAAN Chaperone protein ClpB OS=Staphylococcus aureus (strain N315) GN=clpB PE=1 SV=1 47 777 0.0E+00
sp|Q99VB5|CLPB_STAAM Chaperone protein ClpB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=clpB PE=3 SV=1 47 777 0.0E+00
sp|Q9CB26|CLPB_MYCLE Chaperone protein ClpB OS=Mycobacterium leprae (strain TN) GN=clpB PE=3 SV=1 74 779 0.0E+00
sp|Q7VQF3|CLPB_BLOFL Chaperone protein ClpB OS=Blochmannia floridanus GN=clpB PE=3 SV=1 75 774 0.0E+00
sp|P74459|CLPB1_SYNY3 Chaperone protein ClpB 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=clpB1 PE=3 SV=1 60 790 0.0E+00
sp|Q0E3C8|CLPB3_ORYSJ Chaperone protein ClpB3, mitochondrial OS=Oryza sativa subsp. japonica GN=CLPB3 PE=2 SV=3 60 763 0.0E+00
sp|Q7WHB6|CLPB_BORBR Chaperone protein ClpB OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=clpB PE=3 SV=1 65 760 0.0E+00
sp|Q7W9E6|CLPB_BORPA Chaperone protein ClpB OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=clpB PE=3 SV=1 65 760 0.0E+00
sp|Q7VYV6|CLPB_BORPE Chaperone protein ClpB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=clpB PE=3 SV=1 65 760 0.0E+00
sp|Q8YUL9|CLPB1_NOSS1 Chaperone protein ClpB 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=clpB1 PE=3 SV=1 74 786 0.0E+00
sp|Q81TT4|CLPB_BACAN Chaperone protein ClpB OS=Bacillus anthracis GN=clpB PE=3 SV=1 74 762 0.0E+00
sp|Q7MVE7|CLPB_PORGI Chaperone protein ClpB OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=clpB PE=3 SV=1 70 758 0.0E+00
sp|Q81GM5|CLPB_BACCR Chaperone protein ClpB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=clpB PE=3 SV=1 74 762 0.0E+00
sp|Q73BY1|CLPB_BACC1 Chaperone protein ClpB OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=clpB PE=3 SV=1 74 758 0.0E+00
sp|Q7V2A3|CLPB_PROMP Chaperone protein ClpB OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=clpB PE=3 SV=1 74 775 0.0E+00
sp|Q8DG71|CLPB2_THEEB Chaperone protein ClpB 2 OS=Thermosynechococcus elongatus (strain BP-1) GN=clpB2 PE=3 SV=1 25 758 0.0E+00
sp|P42730|CLPB1_ARATH Chaperone protein ClpB1 OS=Arabidopsis thaliana GN=CLPB1 PE=1 SV=2 74 759 0.0E+00
sp|Q7VJY3|CLPB_HELHP Chaperone protein ClpB OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=clpB PE=3 SV=1 67 775 0.0E+00
sp|O94641|HS104_SCHPO Heat shock protein 104 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp104 PE=3 SV=1 60 775 0.0E+00
sp|Q6MD97|CLPB_PARUW Chaperone protein ClpB OS=Protochlamydia amoebophila (strain UWE25) GN=clpB PE=3 SV=1 74 762 0.0E+00
sp|Q7M9X4|CLPB_WOLSU Chaperone protein ClpB OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=clpB PE=3 SV=1 74 765 0.0E+00
sp|O34209|CLPB2_SYNE7 Chaperone protein ClpB 2 OS=Synechococcus elongatus (strain PCC 7942) GN=clpB2 PE=3 SV=1 73 772 0.0E+00
sp|P31540|HSP98_NEUCR Heat shock protein hsp98 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsp98 PE=1 SV=2 60 788 0.0E+00
sp|O84115|CLPB_CHLTR Chaperone protein ClpB OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=clpB PE=3 SV=1 63 791 0.0E+00
sp|Q9PI02|CLPB_CAMJE Chaperone protein ClpB OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=clpB PE=3 SV=1 74 774 0.0E+00
sp|Q83N78|CLPB_TROW8 Chaperone protein ClpB OS=Tropheryma whipplei (strain TW08/27) GN=clpB PE=3 SV=1 69 776 0.0E+00
sp|Q83FI1|CLPB_TROWT Chaperone protein ClpB OS=Tropheryma whipplei (strain Twist) GN=clpB PE=3 SV=1 69 776 0.0E+00
sp|Q9PKS5|CLPB_CHLMU Chaperone protein ClpB OS=Chlamydia muridarum (strain MoPn / Nigg) GN=clpB PE=3 SV=1 63 770 0.0E+00
sp|P31543|CLP_TRYBB Heat shock protein 100 OS=Trypanosoma brucei brucei GN=HSP100 PE=3 SV=1 70 779 0.0E+00
sp|Q7AJA9|CLPB_CHLPN Chaperone protein ClpB OS=Chlamydia pneumoniae GN=clpB PE=3 SV=1 62 770 0.0E+00
sp|Q822Q4|CLPB_CHLCV Chaperone protein ClpB OS=Chlamydophila caviae (strain GPIC) GN=clpB PE=3 SV=1 62 770 0.0E+00
sp|Q9ZMH1|CLPB_HELPJ Chaperone protein ClpB OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=clpB PE=3 SV=1 74 783 0.0E+00
sp|Q6GBW3|CLPC_STAAS ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus aureus (strain MSSA476) GN=clpC PE=3 SV=1 39 770 0.0E+00
sp|Q6GJE4|CLPC_STAAR ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus aureus (strain MRSA252) GN=clpC PE=3 SV=1 39 770 0.0E+00
sp|Q7A797|CLPC_STAAN ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus aureus (strain N315) GN=clpC PE=1 SV=1 39 770 0.0E+00
sp|Q99W78|CLPC_STAAM ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=clpC PE=3 SV=1 39 770 0.0E+00
sp|P0C281|CLPC_STAAC ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus aureus (strain COL) GN=clpC PE=3 SV=1 39 770 0.0E+00
sp|Q2G0P5|CLPC_STAA8 ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus aureus (strain NCTC 8325) GN=clpC PE=1 SV=1 39 770 0.0E+00
sp|Q2FJB5|CLPC_STAA3 ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus aureus (strain USA300) GN=clpC PE=3 SV=1 39 770 0.0E+00
sp|Q8NXY8|CLPC_STAAW ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus aureus (strain MW2) GN=clpC PE=3 SV=1 39 770 0.0E+00
sp|Q2YSD6|CLPC_STAAB ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=clpC PE=3 SV=1 39 770 0.0E+00
sp|Q6F2Y7|CLPB1_ORYSJ Chaperone protein ClpB1 OS=Oryza sativa subsp. japonica GN=CLPB1 PE=2 SV=1 74 759 0.0E+00
sp|P71404|CLPB_HELPY Chaperone protein ClpB OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=clpB PE=3 SV=2 74 783 0.0E+00
sp|Q49V34|CLPC_STAS1 ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=clpC PE=3 SV=1 39 770 0.0E+00
sp|Q9TM05|CLPC_CYACA ATP-dependent Clp protease ATP-binding subunit ClpA homolog OS=Cyanidium caldarium GN=clpC PE=3 SV=1 59 772 0.0E+00
sp|Q2QVG9|CLPC2_ORYSJ Chaperone protein ClpC2, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC2 PE=2 SV=2 73 776 0.0E+00
sp|Q8CQ88|CLPC_STAES ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus epidermidis (strain ATCC 12228) GN=clpC PE=3 SV=1 39 760 0.0E+00
sp|Q5HRM8|CLPC_STAEQ ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=clpC PE=3 SV=1 39 760 0.0E+00
sp|Q7F9I1|CLPC1_ORYSJ Chaperone protein ClpC1, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC1 PE=2 SV=2 70 786 0.0E+00
sp|Q9FI56|CLPC1_ARATH Chaperone protein ClpC1, chloroplastic OS=Arabidopsis thaliana GN=CLPC1 PE=1 SV=1 65 787 0.0E+00
sp|Q4L3I4|CLPC_STAHJ ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus haemolyticus (strain JCSC1435) GN=clpC PE=3 SV=1 73 777 0.0E+00
sp|P31541|CLPAA_SOLLC ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4A, chloroplastic OS=Solanum lycopersicum GN=CD4A PE=3 SV=1 59 777 0.0E+00
sp|P35100|CLPC_PEA Chaperone protein ClpC, chloroplastic OS=Pisum sativum PE=2 SV=1 73 776 0.0E+00
sp|Q9SXJ7|CLPC2_ARATH Chaperone protein ClpC2, chloroplastic OS=Arabidopsis thaliana GN=CLPC2 PE=1 SV=1 73 772 0.0E+00
sp|Q8EW28|CLPB_MYCPE Chaperone protein ClpB OS=Mycoplasma penetrans (strain HF-2) GN=clpB PE=3 SV=1 64 762 0.0E+00
sp|Q1XDF4|CLPC_PYRYE ATP-dependent Clp protease ATP-binding subunit ClpA homolog OS=Pyropia yezoensis GN=clpC PE=3 SV=1 73 777 0.0E+00
sp|P31539|HS104_YEAST Heat shock protein 104 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP104 PE=1 SV=2 60 783 0.0E+00
sp|P51332|CLPC_PORPU ATP-dependent Clp protease ATP-binding subunit ClpA homolog OS=Porphyra purpurea GN=clpC PE=3 SV=1 73 777 0.0E+00
sp|A0R574|CLPC1_MYCS2 ATP-dependent Clp protease ATP-binding subunit ClpC1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=clpC1 PE=3 SV=1 75 778 0.0E+00
sp|O67588|CLPB_AQUAE Chaperone protein ClpB OS=Aquifex aeolicus (strain VF5) GN=clpB PE=3 SV=1 70 775 0.0E+00
sp|P46523|CLPA_BRANA ATP-dependent Clp protease ATP-binding subunit ClpA homolog, chloroplastic (Fragment) OS=Brassica napus GN=CLPA PE=2 SV=1 68 787 0.0E+00
sp|P37571|CLPC_BACSU Negative regulator of genetic competence ClpC/MecB OS=Bacillus subtilis (strain 168) GN=clpC PE=1 SV=1 73 775 0.0E+00
sp|O78410|CLPC_GUITH ATP-dependent Clp protease ATP-binding subunit ClpA homolog OS=Guillardia theta GN=clpC PE=3 SV=1 73 763 0.0E+00
sp|P24428|CLPC_MYCLE Probable ATP-dependent Clp protease ATP-binding subunit OS=Mycobacterium leprae (strain TN) GN=clpC PE=3 SV=2 75 778 0.0E+00
sp|P47597|CLPB_MYCGE Chaperone protein ClpB OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=clpB PE=3 SV=1 64 772 0.0E+00
sp|P9WPC8|CLPC1_MYCTO ATP-dependent Clp protease ATP-binding subunit ClpC1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=clpC1 PE=2 SV=1 75 778 0.0E+00
sp|P0A523|CLPC_MYCBO Probable ATP-dependent Clp protease ATP-binding subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=clpC PE=3 SV=1 75 778 0.0E+00
sp|P9WPC9|CLPC1_MYCTU ATP-dependent Clp protease ATP-binding subunit ClpC1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=clpC1 PE=1 SV=1 75 778 0.0E+00
sp|Q7NAZ3|CLPB_MYCGA Chaperone protein ClpB OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=clpB PE=3 SV=1 69 767 0.0E+00
sp|P75247|CLPB_MYCPN Chaperone protein ClpB OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=clpB PE=3 SV=1 75 760 0.0E+00
sp|Q7U3T3|CLPB2_SYNPX Chaperone protein ClpB 2 OS=Synechococcus sp. (strain WH8102) GN=clpB2 PE=3 SV=1 71 784 0.0E+00
sp|O84288|CLPC_CHLTR Probable ATP-dependent Clp protease ATP-binding subunit OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=clpC PE=3 SV=1 58 759 0.0E+00
sp|Q53N47|CLPC4_ORYSJ Chaperone protein ClpC4, chloroplastic OS=Oryza sativa subsp. japonica GN=CPLC4 PE=3 SV=1 74 779 0.0E+00
sp|P42762|CLPD_ARATH Chaperone protein ClpD, chloroplastic OS=Arabidopsis thaliana GN=CLPD PE=1 SV=1 67 777 0.0E+00
sp|Q8DTC7|CLPB_STRMU Chaperone protein ClpB OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=clpB PE=3 SV=1 74 761 0.0E+00
sp|Q6H795|CLPD1_ORYSJ Chaperone protein ClpD1, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPD1 PE=2 SV=1 46 776 2.0E-175
sp|Q7XL03|CLPD2_ORYSJ Chaperone protein ClpD2, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPD2 PE=2 SV=2 70 770 9.0E-174
sp|Q2YWB1|CLPL_STAAB ATP-dependent Clp protease ATP-binding subunit ClpL OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=clpL PE=3 SV=1 75 755 4.0E-167
sp|Q6GDQ0|CLPL_STAAR ATP-dependent Clp protease ATP-binding subunit ClpL OS=Staphylococcus aureus (strain MRSA252) GN=clpL PE=3 SV=1 75 755 1.0E-160
sp|Q5XCL7|CLPC_STRP6 Probable ATP-dependent Clp protease ATP-binding subunit OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=clpC PE=1 SV=1 75 755 1.0E-158
sp|F4JVJ1|CLPB2_ARATH Putative chaperone protein ClpB2, chloroplastic OS=Arabidopsis thaliana GN=CLPB2 PE=3 SV=1 74 571 8.0E-157
sp|Q9I742|CLPV1_PSEAE Protein ClpV1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=clpV1 PE=1 SV=1 44 772 3.0E-139
sp|Q9F746|CLPB_YEREN Chaperone protein ClpB OS=Yersinia enterocolitica GN=clpB PE=3 SV=1 75 759 3.0E-137
sp|Q8KA87|CLPB2_CHLTE Probable chaperone protein ClpB 2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=clpB2 PE=3 SV=1 60 345 3.0E-119
sp|Q8KG79|CLPB1_CHLTE Probable chaperone protein ClpB 1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=clpB1 PE=3 SV=1 350 770 1.0E-117
sp|Q8EU05|CLPB_OCEIH Chaperone protein ClpB OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=clpB PE=3 SV=1 73 381 1.0E-107
sp|Q9PKA8|CLPC_CHLMU Probable ATP-dependent Clp protease ATP-binding subunit OS=Chlamydia muridarum (strain MoPn / Nigg) GN=clpC PE=3 SV=1 60 379 8.0E-102
sp|P31542|CLPAB_SOLLC ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4B, chloroplastic OS=Solanum lycopersicum GN=CD4B PE=3 SV=1 69 322 5.0E-101
sp|Q9Z8A6|CLPC_CHLPN Probable ATP-dependent Clp protease ATP-binding subunit OS=Chlamydia pneumoniae GN=clpC PE=3 SV=2 62 379 8.0E-100
sp|Q53LY0|CLPC3_ORYSJ Chaperone protein ClpC3, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC3 PE=2 SV=1 73 324 8.0E-98
sp|Q8EU05|CLPB_OCEIH Chaperone protein ClpB OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=clpB PE=3 SV=1 385 783 7.0E-96
sp|Q54316|HLYB_BRAHO Hemolysin B OS=Brachyspira hyodysenteriae GN=tlyB PE=3 SV=1 73 332 2.0E-94
sp|P31542|CLPAB_SOLLC ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4B, chloroplastic OS=Solanum lycopersicum GN=CD4B PE=3 SV=1 398 777 1.0E-92
sp|Q9S5Z2|CLPE_LACLM ATP-dependent Clp protease ATP-binding subunit ClpE OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=clpE PE=1 SV=2 72 327 1.0E-90
sp|Q9CI09|CLPE_LACLA ATP-dependent Clp protease ATP-binding subunit ClpE OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=clpE PE=3 SV=1 72 327 1.0E-90
sp|P35594|CLPE_STRPN ATP-dependent Clp protease ATP-binding subunit ClpE OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=clpE PE=3 SV=2 69 359 4.0E-90
sp|O31673|CLPE_BACSU ATP-dependent Clp protease ATP-binding subunit ClpE OS=Bacillus subtilis (strain 168) GN=clpE PE=1 SV=1 69 316 2.0E-87
sp|Q53LY0|CLPC3_ORYSJ Chaperone protein ClpC3, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC3 PE=2 SV=1 445 782 6.0E-86
sp|P49574|CLPC_ODOSI ATP-dependent Clp protease ATP-binding subunit ClpA homolog OS=Odontella sinensis GN=clpC PE=3 SV=1 444 776 6.0E-86
sp|Q54316|HLYB_BRAHO Hemolysin B OS=Brachyspira hyodysenteriae GN=tlyB PE=3 SV=1 446 776 2.0E-84
sp|Q9PKA8|CLPC_CHLMU Probable ATP-dependent Clp protease ATP-binding subunit OS=Chlamydia muridarum (strain MoPn / Nigg) GN=clpC PE=3 SV=1 387 759 2.0E-82
sp|P49574|CLPC_ODOSI ATP-dependent Clp protease ATP-binding subunit ClpA homolog OS=Odontella sinensis GN=clpC PE=3 SV=1 73 364 1.0E-81
sp|Q9Z8A6|CLPC_CHLPN Probable ATP-dependent Clp protease ATP-binding subunit OS=Chlamydia pneumoniae GN=clpC PE=3 SV=2 387 759 6.0E-81
sp|Q9S5Z2|CLPE_LACLM ATP-dependent Clp protease ATP-binding subunit ClpE OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=clpE PE=1 SV=2 446 758 7.0E-81
sp|O31673|CLPE_BACSU ATP-dependent Clp protease ATP-binding subunit ClpE OS=Bacillus subtilis (strain 168) GN=clpE PE=1 SV=1 398 755 2.0E-80
sp|P35594|CLPE_STRPN ATP-dependent Clp protease ATP-binding subunit ClpE OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=clpE PE=3 SV=2 445 755 3.0E-80
sp|Q9CI09|CLPE_LACLA ATP-dependent Clp protease ATP-binding subunit ClpE OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=clpE PE=3 SV=1 446 758 7.0E-80
sp|Q7A3F4|CLPL_STAAN ATP-dependent Clp protease ATP-binding subunit ClpL OS=Staphylococcus aureus (strain N315) GN=clpL PE=1 SV=1 384 755 2.0E-79
sp|Q99R88|CLPL_STAAM ATP-dependent Clp protease ATP-binding subunit ClpL OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=clpL PE=3 SV=1 384 755 2.0E-79
sp|Q8NUR7|CLPL_STAAW ATP-dependent Clp protease ATP-binding subunit ClpL OS=Staphylococcus aureus (strain MW2) GN=clpL PE=3 SV=1 384 755 2.0E-79
sp|Q6G6C6|CLPL_STAAS ATP-dependent Clp protease ATP-binding subunit ClpL OS=Staphylococcus aureus (strain MSSA476) GN=clpL PE=3 SV=1 384 755 2.0E-79
sp|Q5HD02|CLPL_STAAC ATP-dependent Clp protease ATP-binding subunit ClpL OS=Staphylococcus aureus (strain COL) GN=clpL PE=3 SV=1 384 755 2.0E-79
sp|Q2FV74|CLPL_STAA8 ATP-dependent Clp protease ATP-binding subunit ClpL OS=Staphylococcus aureus (strain NCTC 8325) GN=clpL PE=2 SV=1 384 755 2.0E-79
sp|Q2FDV8|CLPL_STAA3 ATP-dependent Clp protease ATP-binding subunit ClpL OS=Staphylococcus aureus (strain USA300) GN=clpL PE=3 SV=1 384 755 2.0E-79
sp|P05444|CLPA_RHOBL ClpA homolog protein OS=Rhodobacter blasticus PE=3 SV=1 50 321 4.0E-76
sp|Q7A3F4|CLPL_STAAN ATP-dependent Clp protease ATP-binding subunit ClpL OS=Staphylococcus aureus (strain N315) GN=clpL PE=1 SV=1 75 373 1.0E-75
sp|Q99R88|CLPL_STAAM ATP-dependent Clp protease ATP-binding subunit ClpL OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=clpL PE=3 SV=1 75 373 1.0E-75
sp|Q8NUR7|CLPL_STAAW ATP-dependent Clp protease ATP-binding subunit ClpL OS=Staphylococcus aureus (strain MW2) GN=clpL PE=3 SV=1 75 373 1.0E-75
sp|Q6G6C6|CLPL_STAAS ATP-dependent Clp protease ATP-binding subunit ClpL OS=Staphylococcus aureus (strain MSSA476) GN=clpL PE=3 SV=1 75 373 1.0E-75
sp|Q5HD02|CLPL_STAAC ATP-dependent Clp protease ATP-binding subunit ClpL OS=Staphylococcus aureus (strain COL) GN=clpL PE=3 SV=1 75 373 2.0E-75
sp|Q2FV74|CLPL_STAA8 ATP-dependent Clp protease ATP-binding subunit ClpL OS=Staphylococcus aureus (strain NCTC 8325) GN=clpL PE=2 SV=1 75 373 2.0E-75
sp|Q06716|CLPL_LACLL ATP-dependent Clp protease ATP-binding subunit ClpL OS=Lactococcus lactis subsp. lactis GN=clpL PE=3 SV=1 445 755 2.0E-75
sp|Q2FDV8|CLPL_STAA3 ATP-dependent Clp protease ATP-binding subunit ClpL OS=Staphylococcus aureus (strain USA300) GN=clpL PE=3 SV=1 75 373 3.0E-75
sp|P0ABH9|CLPA_ECOLI ATP-dependent Clp protease ATP-binding subunit ClpA OS=Escherichia coli (strain K12) GN=clpA PE=1 SV=1 67 321 1.0E-73
sp|P0ABI0|CLPA_ECOL6 ATP-dependent Clp protease ATP-binding subunit ClpA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=clpA PE=3 SV=1 67 321 1.0E-73
sp|P0ABI1|CLPA_ECO57 ATP-dependent Clp protease ATP-binding subunit ClpA OS=Escherichia coli O157:H7 GN=clpA PE=3 SV=1 67 321 1.0E-73
sp|P0ABH9|CLPA_ECOLI ATP-dependent Clp protease ATP-binding subunit ClpA OS=Escherichia coli (strain K12) GN=clpA PE=1 SV=1 445 762 2.0E-72
sp|P0ABI0|CLPA_ECOL6 ATP-dependent Clp protease ATP-binding subunit ClpA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=clpA PE=3 SV=1 445 762 2.0E-72
sp|P0ABI1|CLPA_ECO57 ATP-dependent Clp protease ATP-binding subunit ClpA OS=Escherichia coli O157:H7 GN=clpA PE=3 SV=1 445 762 2.0E-72
sp|P05444|CLPA_RHOBL ClpA homolog protein OS=Rhodobacter blasticus PE=3 SV=1 436 789 2.0E-70
sp|Q06716|CLPL_LACLL ATP-dependent Clp protease ATP-binding subunit ClpL OS=Lactococcus lactis subsp. lactis GN=clpL PE=3 SV=1 75 367 7.0E-64
sp|Q60649|CLPB_MOUSE Caseinolytic peptidase B protein homolog OS=Mus musculus GN=Clpb PE=1 SV=1 477 791 1.0E-45
sp|Q9H078|CLPB_HUMAN Caseinolytic peptidase B protein homolog OS=Homo sapiens GN=CLPB PE=1 SV=1 477 786 1.0E-45
sp|Q5E9N5|CLPB_BOVIN Caseinolytic peptidase B protein homolog OS=Bos taurus GN=CLPB PE=2 SV=1 477 774 8.0E-45
sp|Q9WTT2|CLPB_RAT Caseinolytic peptidase B protein homolog OS=Rattus norvegicus GN=Clpb PE=2 SV=1 477 791 1.0E-44
sp|Q51416|AMIB_PSEAE ATP-dependent protease ATP-binding subunit-like protein AmiB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=amiB PE=3 SV=2 479 758 7.0E-43
sp|Q01357|ADPR_RHOER ATP-dependent protease ATP-binding subunit-like protein OS=Rhodococcus erythropolis PE=3 SV=1 477 781 4.0E-39
sp|O15885|CLP_TRYCR Heat shock protein 100 (Fragment) OS=Trypanosoma cruzi GN=HSP100 PE=3 SV=1 660 778 8.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0016887 ATPase activity Yes
GO:0005524 ATP binding Yes
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0032555 purine ribonucleotide binding No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6650
MQARRQFVTSAQRIAGAATRSAQPLALLGAGRIAQRTRLRSLPGLGARHYANGRPHPPGGTHRMNLGGAEEKPAL
EQYGIDLTAKAKDGKLDPVIGRDGEIQRTIQILSRRTKNNPVLIGSAGTGKTAILEGLASRIIRGDVPESIKHKR
VISLDLGSLIAGAKFRGDFEERLKKVLDEVQKAEGQVILFIDELHTLLGLGKAEGSIDASNLLKPALARGELQCC
GATTLDEYRQIEKDVALARRFQPIIVSEPSVEDTISILRGIKDKYEVHHGVRITDGALVSAAALSNRYITDRFLP
DKAIDLMDEAASHLKLQHESKPEDITRLDHKIMTAQIELESLRKESDIASKERREKLEKELKTYHDEISALNARW
DREKAGIEAVKKVQAELDRAKFELEQAQREGNFGRASELRFGVIPDLEQKLPREGEGRQDGEEASLVHDSVTSDD
IANVVSRITGIPVSKLTSGHIEKLVHMEDSLRESVKGQDEAIKAVSDAVRLQRAGLSGENRPLASFFFLGPTGVG
KTELCKKLAGFLFSTESAVVRFDMSEFQEKHTVSRLIGAPSGYVGYEDAGQLTEAVRRKPYAVLLFDEFEKAHRD
ISALLLQVLDEGYLTDAQGHKVDFRNAIIVLTSNLGADILVGQSRQHPYRETADGDVDPSVRQAVLDVVADAYPP
EFLNRIDSFIVFKRLTRAAIRDIVDIRLRDLQRRLDDRRIALSVPDPARDWLADRGYDPKFGARPLNRLITAEIA
NRLADNIIRGRLKMGQAAEVRVRDGGDGLDVVPVAPQTPPS*
Coding >Hirsu2|6650
ATGCAAGCCCGAAGACAATTCGTTACATCAGCCCAGCGCATAGCTGGCGCTGCGACCAGATCCGCGCAACCACTC
GCCCTGCTGGGCGCCGGCCGGATCGCCCAAAGAACGCGACTGCGATCGCTCCCGGGCCTGGGGGCGCGACACTAC
GCAAATGGCCGGCCGCACCCCCCGGGGGGCACGCACCGGATGAACCTGGGCGGGGCGGAGGAGAAGCCGGCGCTG
GAGCAGTACGGCATCGACCTCACCGCCAAGGCCAAGGACGGGAAGCTCGACCCGGTCATCGGACGAGACGGCGAG
ATCCAGCGGACGATTCAGATATTATCGAGACGGACGAAGAATAACCCGGTCCTGATCGGAAGCGCCGGCACGGGC
AAGACGGCGATTCTGGAAGGGCTCGCGTCGCGCATCATCCGCGGGGATGTGCCCGAGAGCATCAAGCACAAGAGG
GTCATCAGCCTGGACCTGGGCTCGCTCATCGCCGGGGCCAAGTTCCGCGGCGACTTCGAGGAACGGCTGAAGAAG
GTGCTGGACGAGGTGCAAAAGGCTGAAGGGCAGGTCATCCTCTTCATCGACGAGCTGCACACGCTCCTCGGCCTC
GGCAAGGCCGAAGGCTCCATCGACGCCTCGAACCTGCTCAAGCCCGCCCTGGCGCGCGGCGAGCTGCAGTGCTGC
GGCGCGACGACGCTCGACGAATACCGGCAGATCGAAAAGGACGTGGCGCTGGCGCGGCGGTTCCAGCCCATCATA
GTCAGCGAGCCGAGCGTGGAAGACACCATCAGCATCCTGAGAGGCATCAAGGACAAGTACGAGGTGCACCACGGC
GTCCGGATCACGGACGGCGCCCTGGTGTCGGCGGCGGCGCTGTCCAACCGGTACATCACGGACCGGTTCCTGCCG
GACAAGGCCATCGACCTGATGGACGAGGCGGCCAGCCACCTCAAGCTGCAGCACGAGTCCAAGCCGGAAGACATC
ACGCGCCTCGACCACAAGATCATGACGGCCCAGATCGAGCTGGAGAGCCTGCGCAAGGAGTCGGACATTGCGAGC
AAGGAGCGGCGGGAGAAGCTGGAGAAGGAGCTCAAGACGTACCACGACGAGATCTCGGCGCTCAACGCCCGCTGG
GACCGGGAAAAGGCCGGGATCGAGGCGGTCAAGAAGGTGCAGGCGGAGCTGGACAGGGCCAAGTTCGAGCTGGAA
CAGGCGCAGCGGGAGGGCAACTTCGGGCGGGCCTCGGAACTCCGCTTCGGCGTCATACCGGACCTGGAGCAGAAG
CTGCCGCGGGAAGGGGAGGGGCGGCAGGACGGCGAGGAGGCGTCGCTGGTGCACGACTCGGTGACGTCGGACGAC
ATCGCCAACGTCGTCTCGCGCATCACCGGCATACCCGTCTCGAAGCTGACGTCGGGACACATCGAGAAGCTGGTG
CACATGGAGGACTCGCTGCGGGAGTCGGTCAAGGGCCAGGACGAGGCGATCAAGGCCGTGTCGGACGCGGTGCGG
CTGCAGCGGGCCGGGCTGAGCGGCGAGAACCGGCCGCTCGCCTCCTTCTTCTTCCTCGGGCCGACGGGGGTGGGT
AAGACGGAGCTGTGCAAGAAGCTGGCCGGCTTCCTCTTCTCGACGGAGTCGGCCGTCGTGCGCTTCGACATGTCC
GAGTTCCAGGAGAAGCACACGGTGTCGCGGCTGATCGGCGCCCCGTCCGGCTACGTCGGCTACGAGGACGCCGGG
CAGCTGACGGAGGCGGTCCGGCGCAAGCCGTACGCCGTCCTGCTCTTCGACGAGTTCGAGAAGGCGCACCGCGAC
ATCTCGGCCCTGCTGCTGCAGGTGCTGGACGAGGGCTACCTGACGGACGCGCAGGGGCACAAGGTCGACTTCCGC
AACGCCATCATCGTCCTGACCTCGAACCTGGGCGCCGACATCCTCGTCGGCCAGAGCCGGCAGCACCCGTACCGC
GAGACGGCCGACGGCGACGTCGACCCCTCGGTCCGCCAGGCCGTCCTCGACGTCGTCGCCGACGCCTACCCGCCC
GAGTTCCTCAACCGCATCGACTCCTTCATCGTCTTCAAGCGCCTGACGCGCGCCGCCATCCGCGACATCGTCGAC
ATCCGCCTGCGCGACCTGCAGCGCCGCCTCGACGACCGCCGCATCGCCCTGTCCGTCCCGGACCCGGCCCGCGAC
TGGCTCGCCGACCGCGGCTACGACCCCAAGTTCGGCGCCCGCCCGCTCAACCGCCTCATCACCGCCGAGATCGCC
AACCGCCTGGCCGACAACATCATCCGCGGCCGGCTCAAGATGGGCCAGGCCGCCGAGGTCCGCGTCCGCGACGGC
GGCGACGGCCTCGACGTCGTGCCCGTCGCGCCCCAGACGCCGCCCTCGTGA
Transcript >Hirsu2|6650
ATGCAAGCCCGAAGACAATTCGTTACATCAGCCCAGCGCATAGCTGGCGCTGCGACCAGATCCGCGCAACCACTC
GCCCTGCTGGGCGCCGGCCGGATCGCCCAAAGAACGCGACTGCGATCGCTCCCGGGCCTGGGGGCGCGACACTAC
GCAAATGGCCGGCCGCACCCCCCGGGGGGCACGCACCGGATGAACCTGGGCGGGGCGGAGGAGAAGCCGGCGCTG
GAGCAGTACGGCATCGACCTCACCGCCAAGGCCAAGGACGGGAAGCTCGACCCGGTCATCGGACGAGACGGCGAG
ATCCAGCGGACGATTCAGATATTATCGAGACGGACGAAGAATAACCCGGTCCTGATCGGAAGCGCCGGCACGGGC
AAGACGGCGATTCTGGAAGGGCTCGCGTCGCGCATCATCCGCGGGGATGTGCCCGAGAGCATCAAGCACAAGAGG
GTCATCAGCCTGGACCTGGGCTCGCTCATCGCCGGGGCCAAGTTCCGCGGCGACTTCGAGGAACGGCTGAAGAAG
GTGCTGGACGAGGTGCAAAAGGCTGAAGGGCAGGTCATCCTCTTCATCGACGAGCTGCACACGCTCCTCGGCCTC
GGCAAGGCCGAAGGCTCCATCGACGCCTCGAACCTGCTCAAGCCCGCCCTGGCGCGCGGCGAGCTGCAGTGCTGC
GGCGCGACGACGCTCGACGAATACCGGCAGATCGAAAAGGACGTGGCGCTGGCGCGGCGGTTCCAGCCCATCATA
GTCAGCGAGCCGAGCGTGGAAGACACCATCAGCATCCTGAGAGGCATCAAGGACAAGTACGAGGTGCACCACGGC
GTCCGGATCACGGACGGCGCCCTGGTGTCGGCGGCGGCGCTGTCCAACCGGTACATCACGGACCGGTTCCTGCCG
GACAAGGCCATCGACCTGATGGACGAGGCGGCCAGCCACCTCAAGCTGCAGCACGAGTCCAAGCCGGAAGACATC
ACGCGCCTCGACCACAAGATCATGACGGCCCAGATCGAGCTGGAGAGCCTGCGCAAGGAGTCGGACATTGCGAGC
AAGGAGCGGCGGGAGAAGCTGGAGAAGGAGCTCAAGACGTACCACGACGAGATCTCGGCGCTCAACGCCCGCTGG
GACCGGGAAAAGGCCGGGATCGAGGCGGTCAAGAAGGTGCAGGCGGAGCTGGACAGGGCCAAGTTCGAGCTGGAA
CAGGCGCAGCGGGAGGGCAACTTCGGGCGGGCCTCGGAACTCCGCTTCGGCGTCATACCGGACCTGGAGCAGAAG
CTGCCGCGGGAAGGGGAGGGGCGGCAGGACGGCGAGGAGGCGTCGCTGGTGCACGACTCGGTGACGTCGGACGAC
ATCGCCAACGTCGTCTCGCGCATCACCGGCATACCCGTCTCGAAGCTGACGTCGGGACACATCGAGAAGCTGGTG
CACATGGAGGACTCGCTGCGGGAGTCGGTCAAGGGCCAGGACGAGGCGATCAAGGCCGTGTCGGACGCGGTGCGG
CTGCAGCGGGCCGGGCTGAGCGGCGAGAACCGGCCGCTCGCCTCCTTCTTCTTCCTCGGGCCGACGGGGGTGGGT
AAGACGGAGCTGTGCAAGAAGCTGGCCGGCTTCCTCTTCTCGACGGAGTCGGCCGTCGTGCGCTTCGACATGTCC
GAGTTCCAGGAGAAGCACACGGTGTCGCGGCTGATCGGCGCCCCGTCCGGCTACGTCGGCTACGAGGACGCCGGG
CAGCTGACGGAGGCGGTCCGGCGCAAGCCGTACGCCGTCCTGCTCTTCGACGAGTTCGAGAAGGCGCACCGCGAC
ATCTCGGCCCTGCTGCTGCAGGTGCTGGACGAGGGCTACCTGACGGACGCGCAGGGGCACAAGGTCGACTTCCGC
AACGCCATCATCGTCCTGACCTCGAACCTGGGCGCCGACATCCTCGTCGGCCAGAGCCGGCAGCACCCGTACCGC
GAGACGGCCGACGGCGACGTCGACCCCTCGGTCCGCCAGGCCGTCCTCGACGTCGTCGCCGACGCCTACCCGCCC
GAGTTCCTCAACCGCATCGACTCCTTCATCGTCTTCAAGCGCCTGACGCGCGCCGCCATCCGCGACATCGTCGAC
ATCCGCCTGCGCGACCTGCAGCGCCGCCTCGACGACCGCCGCATCGCCCTGTCCGTCCCGGACCCGGCCCGCGAC
TGGCTCGCCGACCGCGGCTACGACCCCAAGTTCGGCGCCCGCCCGCTCAACCGCCTCATCACCGCCGAGATCGCC
AACCGCCTGGCCGACAACATCATCCGCGGCCGGCTCAAGATGGGCCAGGCCGCCGAGGTCCGCGTCCGCGACGGC
GGCGACGGCCTCGACGTCGTGCCCGTCGCGCCCCAGACGCCGCCCTCGTGA
Gene >Hirsu2|6650
ATGCAAGCCCGAAGACAATTCGTTACATCAGCCCAGCGCATAGCTGGCGCTGCGACCAGATCCGCGCAACCACTC
GCCCTGCTGGGCGCCGGCCGGATCGCCCAAAGAACGCGACTGCGATCGCTCCCGGGCCTGGGGGCGCGACACTAC
GCAAATGGCCGGCCGCACCCCCCGGGGGGCACGCACCGGATGAACCTGGGCGGGGCGGAGGAGAAGCCGGCGCTG
GAGCAGTACGGCATCGACCTCACCGCCAAGGCCAAGGACGGGAAGCTCGACCCGGTCATCGGACGAGACGGCGAG
ATCCAGCGGACGATTCAGATATTATCGAGACGGACGAAGAATAACCCGGTCCTGATCGGAAGCGCCGGCACGGGC
AAGACGGCGATTCTGGAAGGGCTCGCGTCGCGCATCATCCGCGGGGATGTGCCCGAGAGCATCAAGCACAAGAGG
GTCATCAGCCTGGACCTGGGCTCGCTCATCGCCGGGGCCAAGTTCCGCGGCGACTTCGAGGAACGGCTGAAGAAG
GTGCTGGACGAGGTGCAAAAGGCTGAAGGGCAGGTCATCCTCTTCATCGACGAGCTGCACACGCTCCTCGGCCTC
GGCAAGGCCGAAGGCTCCATCGACGCCTCGAACCTGCTCAAGCCCGCCCTGGCGCGCGGCGAGCTGCAGTGCTGC
GGCGCGACGACGCTCGACGAATACCGGCAGATCGAAAAGGACGTGGCGCTGGCGCGGCGGTTCCAGCCCATCATA
GTCAGCGAGCCGAGCGTGGAAGACACCATCAGCATCCTGAGAGGCATCAAGGACAAGTACGAGGTGCACCACGGC
GTCCGGATCACGGACGGCGCCCTGGTGTCGGCGGCGGCGCTGTCCAACCGGTACATCACGGACCGGTTCCTGCCG
GACAAGGCCATCGACCTGATGGACGAGGCGGCCAGCCACCTCAAGCTGCAGCACGAGTCCAAGCCGGAAGACATC
ACGCGCCTCGACCACAAGATCATGACGGCCCAGATCGAGCTGGAGAGCCTGCGCAAGGAGTCGGACATTGCGAGC
AAGGAGCGGCGGGAGAAGCTGGAGAAGGAGCTCAAGACGTACCACGACGAGATCTCGGCGCTCAACGCCCGCTGG
GACCGGGAAAAGGCCGGGATCGAGGCGGTCAAGAAGGTGCAGGCGGAGCTGGACAGGGCCAAGTTCGAGCTGGAA
CAGGCGCAGCGGGAGGGCAACTTCGGGCGGGCCTCGGAACTCCGCTTCGGCGTCATACCGGACCTGGAGCAGAAG
CTGCCGCGGGAAGGGGAGGGGCGGCAGGACGGCGAGGAGGCGTCGCTGGTGCACGACTCGGTGACGTCGGACGAC
ATCGCCAACGTCGTCTCGCGCATCACCGGCATACCCGTCTCGAAGCTGACGTCGGGACACATCGAGAAGCTGGTG
CACATGGAGGACTCGCTGCGGGAGTCGGTCAAGGGCCAGGACGAGGCGATCAAGGCCGTGTCGGACGCGGTGCGG
CTGCAGCGGGCCGGGCTGAGCGGCGAGAACCGGCCGCTCGCCTCCTTCTTCTTCCTCGGGCCGACGGGGGTGGGT
AAGACGGAGCTGTGCAAGAAGCTGGCCGGCTTCCTCTTCTCGACGGAGTCGGCCGTCGTGCGCTTCGACATGTCC
GAGTTCCAGGAGAAGCACACGGTGTCGCGGCTGATCGGCGCCCCGTCCGGCTACGTCGGCTACGAGGACGCCGGG
CAGCTGACGGAGGCGGTCCGGCGCAAGCCGTACGCCGTCCTGCTCTTCGACGAGTTCGAGAAGGCGCACCGCGAC
ATCTCGGCCCTGCTGCTGCAGGTGCTGGACGAGGGCTACCTGACGGACGCGCAGGGGCACAAGGTCGACTTCCGC
AACGCCATCATCGTCCTGACCTCGAACCTGGGCGCCGACATCCTCGTCGGCCAGAGCCGGCAGCACCCGTACCGC
GAGACGGCCGACGGCGACGTCGACCCCTCGGTCCGCCAGGCCGTCCTCGACGTCGTCGCCGACGCCTACCCGCCC
GAGTTCCTCAACCGCATCGACTCCTTCATCGTCTTCAAGCGCCTGACGCGCGCCGCCATCCGCGACATCGTCGAC
ATCCGCCTGCGCGACCTGCAGCGCCGCCTCGACGACCGCCGCATCGCCCTGTCCGTCCCGGACCCGGCCCGCGAC
TGGCTCGCCGACCGCGGCTACGACCCCAAGTTCGGCGCCCGCCCGCTCAACCGCCTCATCACCGCCGAGATCGCC
AACCGCCTGGCCGACAACATCATCCGCGGCCGGCTCAAGATGGGCCAGGCCGCCGAGGTCCGCGTCCGCGACGGC
GGCGACGGCCTCGACGTCGTGCCCGTCGCGCCCCAGACGCCGCCCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail