Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6647
Gene name
LocationContig_347:19807..22100
Strand-
Gene length (bp)2293
Transcript length (bp)2115
Coding sequence length (bp)2115
Protein length (aa) 705

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase 8.1E-06 588 623
PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase 2.8E-06 647 681
PF00132 Hexapep Bacterial transferase hexapeptide (six repeats) 1.3E-06 648 681
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 1.1E-09 235 270
PF12464 Mac Maltose acetyltransferase 2.6E-09 498 549

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P37515|MAA_BACSU Probable maltose O-acetyltransferase OS=Bacillus subtilis (strain 168) GN=maa PE=3 SV=1 492 698 1.0E-39
sp|P28266|NODL_RHIME Nodulation protein L OS=Rhizobium meliloti (strain 1021) GN=nodL PE=3 SV=1 492 696 3.0E-39
sp|P08632|NODL_RHILV Nodulation protein L OS=Rhizobium leguminosarum bv. viciae GN=nodL PE=3 SV=1 492 696 6.0E-38
sp|P77791|MAA_ECOLI Maltose O-acetyltransferase OS=Escherichia coli (strain K12) GN=maa PE=1 SV=3 493 698 7.0E-35
sp|Q6GDP3|ATRF2_STAAR Putative acetyltransferase SAR2635 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2635 PE=3 SV=1 493 700 2.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P37515|MAA_BACSU Probable maltose O-acetyltransferase OS=Bacillus subtilis (strain 168) GN=maa PE=3 SV=1 492 698 1.0E-39
sp|P28266|NODL_RHIME Nodulation protein L OS=Rhizobium meliloti (strain 1021) GN=nodL PE=3 SV=1 492 696 3.0E-39
sp|P08632|NODL_RHILV Nodulation protein L OS=Rhizobium leguminosarum bv. viciae GN=nodL PE=3 SV=1 492 696 6.0E-38
sp|P77791|MAA_ECOLI Maltose O-acetyltransferase OS=Escherichia coli (strain K12) GN=maa PE=1 SV=3 493 698 7.0E-35
sp|Q6GDP3|ATRF2_STAAR Putative acetyltransferase SAR2635 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2635 PE=3 SV=1 493 700 2.0E-32
sp|Q7A3E8|ATRF2_STAAN Putative acetyltransferase SA2342 OS=Staphylococcus aureus (strain N315) GN=SA2342 PE=1 SV=1 493 700 2.0E-31
sp|Q7A2K9|ATRF2_STAAM Putative acetyltransferase SAV2555 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2555 PE=3 SV=1 493 700 2.0E-31
sp|Q9KWJ8|ATRF2_STAA1 Putative acetyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=SAHV_2539 PE=3 SV=1 493 700 2.0E-31
sp|Q4L967|ATRF2_STAHJ Putative acetyltransferase SH0499 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0499 PE=3 SV=1 493 700 3.0E-31
sp|Q8NUR1|ATRF2_STAAW Putative acetyltransferase MW2476 OS=Staphylococcus aureus (strain MW2) GN=MW2476 PE=3 SV=1 493 700 5.0E-31
sp|Q6G6B9|ATRF2_STAAS Putative acetyltransferase SAS2441 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2441 PE=3 SV=1 493 700 5.0E-31
sp|Q5HCZ5|ATRF2_STAAC Putative acetyltransferase SACOL2570 OS=Staphylococcus aureus (strain COL) GN=SACOL2570 PE=1 SV=1 493 700 5.0E-31
sp|Q552S7|Y5913_DICDI Putative acetyltransferase DDB_G0275913 OS=Dictyostelium discoideum GN=DDB_G0275913 PE=3 SV=1 491 702 8.0E-31
sp|Q09707|YA39_SCHPO Putative acetyltransferase C18B11.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC18B11.09c PE=3 SV=2 491 700 9.0E-31
sp|P40892|YJV8_YEAST Putative acetyltransferase YJL218W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL218W PE=1 SV=1 577 700 2.0E-28
sp|Q54UU2|Y0825_DICDI Putative acetyltransferase DDB_G0280825 OS=Dictyostelium discoideum GN=DDB_G0280825 PE=3 SV=1 493 702 3.0E-27
sp|Q86A05|Y5507_DICDI Putative acetyltransferase DDB_G0275507 OS=Dictyostelium discoideum GN=DDB_G0275507 PE=3 SV=1 493 698 8.0E-27
sp|P52984|THGA_LACLA Galactoside O-acetyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lacA PE=3 SV=1 491 700 3.0E-24
sp|P07464|THGA_ECOLI Galactoside O-acetyltransferase OS=Escherichia coli (strain K12) GN=lacA PE=1 SV=1 541 700 5.0E-23
sp|Q58464|Y1064_METJA Uncharacterized acetyltransferase MJ1064 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1064 PE=3 SV=1 589 698 4.0E-13
sp|Q06750|CYSE_BACSU Serine acetyltransferase OS=Bacillus subtilis (strain 168) GN=cysE PE=1 SV=1 589 697 7.0E-13
sp|A7GS09|DAPH_BACCN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dapH PE=3 SV=1 609 700 8.0E-13
sp|A1ADJ6|NEUO_ECOK1 Polysialic acid O-acetyltransferase OS=Escherichia coli O1:K1 / APEC GN=neuO PE=1 SV=1 592 698 9.0E-13
sp|B7GIC1|DAPH_ANOFW 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=dapH PE=3 SV=1 585 700 2.0E-12
sp|B9K867|DAPH_THENN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dapH PE=3 SV=1 647 700 2.0E-12
sp|Q39218|SAT3_ARATH Serine acetyltransferase 3, mitochondrial OS=Arabidopsis thaliana GN=SAT3 PE=1 SV=3 597 699 3.0E-12
sp|A8F961|CYSE_BACP2 Serine acetyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=cysE PE=3 SV=1 589 697 4.0E-12
sp|Q65PC9|CYSE_BACLD Serine acetyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cysE PE=3 SV=1 597 697 9.0E-12
sp|Q8W0E4|SAT1_ORYSJ Probable serine acetyltransferase 1 OS=Oryza sativa subsp. japonica GN=SAT1 PE=2 SV=1 597 699 2.0E-11
sp|Q8ERA4|DAPH_OCEIH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dapH PE=3 SV=1 585 700 4.0E-11
sp|Q42588|SAT1_ARATH Serine acetyltransferase 1, chloroplastic OS=Arabidopsis thaliana GN=SAT1 PE=1 SV=2 597 699 7.0E-11
sp|P32003|CYSE_BUCAP Serine acetyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cysE PE=3 SV=1 597 700 3.0E-10
sp|A9BHR6|DAPH_PETMO 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=dapH PE=3 SV=1 610 700 3.0E-10
sp|O74308|YOG2_SCHPO Uncharacterized transcriptional regulatory protein C15D4.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.02 PE=3 SV=3 226 313 4.0E-10
sp|P23364|CAT4_AGRFC Chloramphenicol acetyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cat PE=3 SV=1 628 698 4.0E-10
sp|Q0DGG8|SAT5_ORYSJ Probable serine acetyltransferase 5 OS=Oryza sativa subsp. japonica GN=SAT5 PE=2 SV=2 596 697 5.0E-10
sp|P50868|CAT4_ENTAE Chloramphenicol acetyltransferase OS=Enterobacter aerogenes GN=catB4 PE=3 SV=1 604 698 6.0E-10
sp|Q6T1W7|FDTC_ANETH dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose 3-N-acetyltransferase OS=Aneurinibacillus thermoaerophilus GN=fdtC PE=1 SV=1 583 696 7.0E-10
sp|Q2YXZ7|DAPH_STAAB 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dapH PE=3 SV=1 647 698 7.0E-10
sp|A5I6N5|DAPH_CLOBH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=dapH PE=3 SV=1 648 698 8.0E-10
sp|A7FYA5|DAPH_CLOB1 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=dapH PE=3 SV=1 648 698 8.0E-10
sp|C5CHX7|DAPH_KOSOT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=dapH PE=3 SV=1 611 699 8.0E-10
sp|B1IMX1|DAPH_CLOBK 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=dapH PE=3 SV=1 648 698 9.0E-10
sp|C1FL32|DAPH_CLOBJ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=dapH PE=3 SV=1 648 698 9.0E-10
sp|A7GI22|DAPH_CLOBL 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=dapH PE=3 SV=1 648 698 9.0E-10
sp|B1L0V4|DAPH_CLOBM 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=dapH PE=3 SV=1 648 698 9.0E-10
sp|C3KTL7|DAPH_CLOB6 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=dapH PE=3 SV=1 648 698 1.0E-09
sp|B7IF15|DAPH_THEAB 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermosipho africanus (strain TCF52B) GN=dapH PE=3 SV=1 586 700 2.0E-09
sp|Q8RBI7|DAPH_CALS4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dapH PE=3 SV=1 589 698 2.0E-09
sp|P26838|CAT4_ECOLX Chloramphenicol acetyltransferase OS=Escherichia coli GN=catB2 PE=3 SV=2 604 698 2.0E-09
sp|P50870|VATD_ENTFC Streptogramin A acetyltransferase OS=Enterococcus faecium GN=vatD PE=1 SV=1 603 698 3.0E-09
sp|Q8S895|SAT2_ARATH Serine acetyltransferase 2 OS=Arabidopsis thaliana GN=SAT2 PE=1 SV=2 512 698 3.0E-09
sp|Q03CW1|DAPH_LACC3 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=dapH PE=3 SV=1 586 700 3.0E-09
sp|A6LP60|DAPH_THEM4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dapH PE=3 SV=1 586 700 3.0E-09
sp|Q7A0X6|DAPH_STAAW 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain MW2) GN=dapH PE=3 SV=1 647 698 3.0E-09
sp|Q9EZ10|DAPH_STAAU 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus GN=dapH PE=3 SV=1 647 698 3.0E-09
sp|A8Z3X5|DAPH_STAAT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dapH PE=3 SV=1 647 698 3.0E-09
sp|Q6G9G4|DAPH_STAAS 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=dapH PE=3 SV=1 647 698 3.0E-09
sp|Q7A5P7|DAPH_STAAN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain N315) GN=dapH PE=3 SV=1 647 698 3.0E-09
sp|Q7A2S0|DAPH_STAAM 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dapH PE=1 SV=1 647 698 3.0E-09
sp|Q5HG23|DAPH_STAAC 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain COL) GN=dapH PE=3 SV=1 647 698 3.0E-09
sp|A5ISS9|DAPH_STAA9 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain JH9) GN=dapH PE=3 SV=1 647 698 3.0E-09
sp|Q2FYN7|DAPH_STAA8 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=dapH PE=3 SV=1 647 698 3.0E-09
sp|Q2FH41|DAPH_STAA3 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain USA300) GN=dapH PE=3 SV=1 647 698 3.0E-09
sp|A6U1L8|DAPH_STAA2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain JH1) GN=dapH PE=3 SV=1 647 698 3.0E-09
sp|A7X274|DAPH_STAA1 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dapH PE=3 SV=1 647 698 3.0E-09
sp|Q42538|SAT5_ARATH Serine acetyltransferase 5 OS=Arabidopsis thaliana GN=SAT5 PE=1 SV=1 597 699 3.0E-09
sp|Q6GH11|DAPH_STAAR 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=dapH PE=3 SV=1 647 698 4.0E-09
sp|P0ACD3|WCAF_SHIFL Putative colanic acid biosynthesis acetyltransferase WcaF OS=Shigella flexneri GN=wcaF PE=3 SV=1 569 698 4.0E-09
sp|P0ACD2|WCAF_ECOLI Putative colanic acid biosynthesis acetyltransferase WcaF OS=Escherichia coli (strain K12) GN=wcaF PE=3 SV=1 569 698 4.0E-09
sp|P39856|CAPG_STAAU Protein CapG OS=Staphylococcus aureus GN=capG PE=3 SV=1 647 700 7.0E-09
sp|B0K4I5|DAPH_THEPX 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=dapH PE=3 SV=1 589 698 8.0E-09
sp|Q5FKR1|DAPH_LACAC 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=dapH PE=3 SV=1 589 698 8.0E-09
sp|B0KAL9|DAPH_THEP3 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=dapH PE=3 SV=1 589 698 1.0E-08
sp|B3W7E7|DAPH_LACCB 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus casei (strain BL23) GN=dapH PE=3 SV=1 586 700 1.0E-08
sp|P26841|CAT4_PSEAE Chloramphenicol acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cat PE=1 SV=3 604 698 1.0E-08
sp|C4L2D4|DAPH_EXISA 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=dapH PE=3 SV=1 589 698 1.0E-08
sp|P50869|CAT4_MORMO Chloramphenicol acetyltransferase OS=Morganella morganii GN=cat PE=3 SV=1 604 698 2.0E-08
sp|Q7A1G0|ATRF1_STAAW Putative acetyltransferase MW0724 OS=Staphylococcus aureus (strain MW2) GN=MW0724 PE=3 SV=1 609 693 2.0E-08
sp|Q6GB68|ATRF1_STAAS Putative acetyltransferase SAS0727 OS=Staphylococcus aureus (strain MSSA476) GN=SAS0727 PE=3 SV=1 609 693 2.0E-08
sp|Q6GIM9|ATRF1_STAAR Putative acetyltransferase SAR0816 OS=Staphylococcus aureus (strain MRSA252) GN=SAR0816 PE=3 SV=1 609 693 2.0E-08
sp|Q7A6Q9|ATRF1_STAAN Putative acetyltransferase SA0717 OS=Staphylococcus aureus (strain N315) GN=SA0717 PE=3 SV=1 609 693 2.0E-08
sp|Q99VL4|ATRF1_STAAM Putative acetyltransferase SAV0762 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0762 PE=3 SV=1 609 693 2.0E-08
sp|Q5HHQ6|ATRF1_STAAC Putative acetyltransferase SACOL0827 OS=Staphylococcus aureus (strain COL) GN=SACOL0827 PE=3 SV=1 609 693 2.0E-08
sp|A6QGU8|DAPH_STAAE 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain Newman) GN=dapH PE=3 SV=1 647 698 2.0E-08
sp|Q9UT46|MOC3_SCHPO Transcriptional regulatory protein moc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=moc3 PE=1 SV=4 222 268 2.0E-08
sp|Q03YE4|DAPH_LEUMM 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=dapH PE=3 SV=1 608 700 3.0E-08
sp|B9DP25|DAPH_STACT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus carnosus (strain TM300) GN=dapH PE=3 SV=1 647 698 3.0E-08
sp|P26839|VATA_STAAU Virginiamycin A acetyltransferase OS=Staphylococcus aureus GN=vat PE=1 SV=2 593 698 4.0E-08
sp|C1CU00|DAPH_STRZT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dapH PE=3 SV=1 608 700 5.0E-08
sp|Q10S58|SAT2_ORYSJ Probable serine acetyltransferase 2 OS=Oryza sativa subsp. japonica GN=SAT2 PE=2 SV=1 597 697 5.0E-08
sp|A3CQT5|DAPH_STRSV 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus sanguinis (strain SK36) GN=dapH PE=3 SV=1 641 700 6.0E-08
sp|B1YJ41|DAPH_EXIS2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=dapH PE=3 SV=1 647 698 6.0E-08
sp|A8AUL9|DAPH_STRGC 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=dapH PE=3 SV=1 641 700 7.0E-08
sp|P29847|CYSE_SALTY Serine acetyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysE PE=1 SV=1 597 697 8.0E-08
sp|C1CH25|DAPH_STRZJ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain JJA) GN=dapH PE=3 SV=1 641 700 9.0E-08
sp|Q8DN54|DAPH_STRR6 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dapH PE=3 SV=1 641 700 9.0E-08
sp|B8ZPL9|DAPH_STRPJ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dapH PE=3 SV=1 641 700 9.0E-08
sp|B1I9G3|DAPH_STRPI 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=dapH PE=3 SV=1 641 700 9.0E-08
sp|C1CAS4|DAPH_STRP7 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=dapH PE=3 SV=1 641 700 9.0E-08
sp|B5E3A4|DAPH_STRP4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=dapH PE=3 SV=1 641 700 9.0E-08
sp|Q04I77|DAPH_STRP2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dapH PE=3 SV=1 641 700 9.0E-08
sp|Q8DVY7|DAPH_STRMU 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dapH PE=3 SV=1 641 700 9.0E-08
sp|C1CN43|DAPH_STRZP 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain P1031) GN=dapH PE=3 SV=1 641 700 9.0E-08
sp|B2IN15|DAPH_STRPS 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=dapH PE=3 SV=1 641 700 9.0E-08
sp|Q97NE6|DAPH_STRPN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dapH PE=3 SV=1 641 700 9.0E-08
sp|Q03IN0|DAPH_STRTD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=dapH PE=3 SV=1 641 700 1.0E-07
sp|Q5M2I4|DAPH_STRT2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=dapH PE=3 SV=1 641 700 1.0E-07
sp|Q5LXY2|DAPH_STRT1 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=dapH PE=3 SV=1 641 700 1.0E-07
sp|Q6LAN4|DAPH_LISIV 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Listeria ivanovii GN=dapH PE=3 SV=1 647 698 1.0E-07
sp|Q4L6A2|DAPH_STAHJ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dapH PE=3 SV=1 647 698 1.0E-07
sp|A4VY24|DAPH_STRSY 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=dapH PE=3 SV=2 641 700 2.0E-07
sp|A4W4B5|DAPH_STRS2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus suis (strain 98HAH33) GN=dapH PE=3 SV=1 641 700 2.0E-07
sp|P0A9D7|CYSE_SHIFL Serine acetyltransferase OS=Shigella flexneri GN=cysE PE=3 SV=1 597 697 2.0E-07
sp|P0A9D4|CYSE_ECOLI Serine acetyltransferase OS=Escherichia coli (strain K12) GN=cysE PE=1 SV=1 597 697 2.0E-07
sp|P0A9D5|CYSE_ECOL6 Serine acetyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysE PE=3 SV=1 597 697 2.0E-07
sp|P0A9D6|CYSE_ECO57 Serine acetyltransferase OS=Escherichia coli O157:H7 GN=cysE PE=3 SV=1 597 697 2.0E-07
sp|B9DVY7|DAPH_STRU0 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=dapH PE=3 SV=1 641 700 2.0E-07
sp|P37750|WBBJ_ECOLI Putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ OS=Escherichia coli (strain K12) GN=wbbJ PE=3 SV=2 643 698 3.0E-07
sp|B1MZN0|DAPH_LEUCK 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Leuconostoc citreum (strain KM20) GN=dapH PE=3 SV=1 641 700 4.0E-07
sp|P26840|MATA_LYSSH Probable macrolide acetyltransferase (Fragment) OS=Lysinibacillus sphaericus PE=3 SV=1 639 698 4.0E-07
sp|Q88V23|DAPH_LACPL 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dapH PE=3 SV=1 589 700 4.0E-07
sp|Q8W2B8|SAT4_ARATH Serine acetyltransferase 4 OS=Arabidopsis thaliana GN=SAT4 PE=1 SV=1 597 697 5.0E-07
sp|O34993|YVOF_BACSU Putative acetyltransferase YvoF OS=Bacillus subtilis (strain 168) GN=yvoF PE=3 SV=1 608 697 5.0E-07
sp|G3XD01|WBPD_PSEAE UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=wbpD PE=1 SV=1 586 695 5.0E-07
sp|A6LUD2|DAPH_CLOB8 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dapH PE=3 SV=1 648 700 6.0E-07
sp|Q10QH1|SAT4_ORYSJ Probable serine acetyltransferase 4 OS=Oryza sativa subsp. japonica GN=SAT4 PE=2 SV=1 585 704 6.0E-07
sp|O53281|Y3034_MYCTU Putative acetyltransferase Rv3034c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3034c PE=1 SV=1 588 698 1.0E-06
sp|Q721F5|DAPH_LISMF 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dapH PE=3 SV=1 608 698 1.0E-06
sp|C1L1T2|DAPH_LISMC 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dapH PE=3 SV=1 608 698 1.0E-06
sp|B2V5B7|DAPH_CLOBA 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dapH PE=3 SV=1 589 700 1.0E-06
sp|B1LBQ9|DAPH_THESQ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermotoga sp. (strain RQ2) GN=dapH PE=3 SV=1 641 700 1.0E-06
sp|Q8Y8A1|DAPH_LISMO 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dapH PE=3 SV=1 608 698 2.0E-06
sp|A0AHD1|DAPH_LISW6 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dapH PE=3 SV=1 608 698 2.0E-06
sp|B8DEC4|DAPH_LISMH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dapH PE=3 SV=1 608 698 2.0E-06
sp|Q92D11|DAPH_LISIN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dapH PE=3 SV=1 608 698 2.0E-06
sp|B2TS78|DAPH_CLOBB 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dapH PE=3 SV=1 648 698 2.0E-06
sp|A4ILT5|DAPH_GEOTN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=dapH PE=3 SV=1 574 700 2.0E-06
sp|Q5ANB1|WOR2_CANAL White-opaque regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=WOR2 PE=1 SV=1 236 267 2.0E-06
sp|A5IM64|DAPH_THEP1 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dapH PE=3 SV=1 641 700 2.0E-06
sp|Q97GI6|DAPH_CLOAB 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dapH PE=3 SV=1 649 698 3.0E-06
sp|P77985|CYSE_STAXY Serine acetyltransferase OS=Staphylococcus xylosus GN=cysE PE=3 SV=1 597 701 3.0E-06
sp|Q9CIS5|DAPH_LACLA 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dapH PE=3 SV=1 652 700 6.0E-06
sp|Q6GBV9|CYSE_STAAS Serine acetyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=cysE PE=3 SV=1 597 702 6.0E-06
sp|Q6GJE0|CYSE_STAAR Serine acetyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=cysE PE=3 SV=1 597 702 6.0E-06
sp|A2RI05|DAPH_LACLM 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=dapH PE=3 SV=1 652 700 7.0E-06
sp|P67766|CYSE_STAAW Serine acetyltransferase OS=Staphylococcus aureus (strain MW2) GN=cysE PE=3 SV=1 597 702 7.0E-06
sp|P67765|CYSE_STAAN Serine acetyltransferase OS=Staphylococcus aureus (strain N315) GN=cysE PE=1 SV=1 597 702 7.0E-06
sp|P67764|CYSE_STAAM Serine acetyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cysE PE=3 SV=1 597 702 7.0E-06
sp|Q5HIE6|CYSE_STAAC Serine acetyltransferase OS=Staphylococcus aureus (strain COL) GN=cysE PE=3 SV=1 597 702 7.0E-06
sp|B2G6M7|DAPH_LACRJ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus reuteri (strain JCM 1112) GN=dapH PE=3 SV=1 589 700 8.0E-06
sp|A5VJ56|DAPH_LACRD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus reuteri (strain DSM 20016) GN=dapH PE=3 SV=1 589 700 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0016407 acetyltransferase activity Yes
GO:0008270 zinc ion binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0005634 nucleus Yes
GO:0043169 cation binding No
GO:0065007 biological regulation No
GO:0010468 regulation of gene expression No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0005488 binding No
GO:0046872 metal ion binding No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0043226 organelle No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0060255 regulation of macromolecule metabolic process No
GO:0044464 cell part No
GO:0043227 membrane-bounded organelle No
GO:2001141 regulation of RNA biosynthetic process No
GO:0043167 ion binding No
GO:0044424 intracellular part No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0016747 transferase activity, transferring acyl groups other than amino-acyl groups No
GO:0050789 regulation of biological process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0031323 regulation of cellular metabolic process No
GO:0016746 transferase activity, transferring acyl groups No
GO:0043231 intracellular membrane-bounded organelle No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0003700 DNA-binding transcription factor activity No
GO:0046914 transition metal ion binding No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6647
MSTFTALNGTSPKTTDPPPHPKSSGTSADKAGLDDPSLGPAAFRPRKSPDASAAAAAALHKESWRGQDRHPFPPA
SYPDAEASHKRKRSPSPSLDLRREPSARQSTPETAPAPDTRASRATPQRDFRHCSDDQRDGDSSSWQSLQGRDDR
GPYDGQHGSATSASAHADDQMGDALRRAAAQGQMDHSDYSHTSPDAEDRSAPVYGSPYGPDHRQDSVPQHDPKKR
KRNFSNRTKTGCLTCRKRKKKCDEHKPECSNCIRGGFVCAGYPPQRGPGWQKPDNKAAAVPLESKDPSYVPPGAY
GMPQHGSASYATQPPVKREPLPHYRGQSLRIDPPQGRPLAMSDDDRPTASTLASASAASPDSKLSAMAYGPGAVF
PTPVSANTQPPPPFGDRPPPAKDYQRVPPLHDLQSRSEPETPHPANALPQINILHPTRASSPTPHAQQQPQQQQQ
QPPPPPPPPPPPPPPPPSSSSSSSAQVAAQLALSHPQYPQRRTQKEEMLSGRHFYPFDKELCLERERCAVACWRF
NNLTTPPTHGVSPDERARLFLEILQPRDPVRVSPTEASPVTNVGRVGRHVAVETPFTCDYGYNISIGHHVVLGRN
CTINDVCEVKIGDNCVVGPNVSIFTATLPIDPKKRQGGQGPQQGRAITIEQDCWIGGGAIILPGRTIGKGSTVGA
GSIVTKDVPPFTVVAGNPARVLRGIGIAP*
Coding >Hirsu2|6647
ATGTCCACCTTCACCGCCCTCAATGGGACCTCACCCAAGACGACCGATCCGCCGCCGCATCCCAAGAGCAGCGGC
ACCTCGGCCGACAAGGCCGGCCTCGACGACCCCTCCCTAGGCCCGGCCGCCTTCCGGCCCCGGAAGTCGCCTGAT
GCCTCCGCCGCCGCCGCCGCCGCCCTCCACAAGGAGTCGTGGCGCGGCCAGGACCGGCACCCATTCCCGCCCGCC
AGCTACCCCGACGCCGAGGCCTCCCACAAGCGCAAGCGCTCGCCCTCGCCCTCGCTCGACCTGAGGCGCGAGCCT
TCCGCCCGCCAATCGACGCCCGAGACGGCGCCGGCGCCCGACACGCGCGCCTCTCGTGCCACGCCCCAGCGCGAC
TTCCGCCACTGCAGCGACGATCAGCGCGACGGCGACTCGTCCTCCTGGCAGTCCCTCCAGGGCCGCGACGACAGG
GGCCCGTACGACGGCCAGCACGGCTCCGCCACCTCGGCCTCGGCCCACGCCGACGACCAGATGGGCGACGCCCTG
CGCAGGGCCGCCGCCCAGGGCCAGATGGACCACAGCGACTACAGCCACACGAGCCCCGACGCCGAGGACAGGTCC
GCCCCCGTCTACGGCAGTCCCTACGGGCCCGACCACCGTCAGGATTCCGTCCCCCAGCACGACCCCAAGAAGCGG
AAGCGCAACTTCAGCAACCGCACCAAGACGGGCTGCCTCACCTGTCGCAAGCGCAAGAAGAAGTGCGACGAGCAC
AAGCCCGAGTGCAGCAACTGCATCCGAGGCGGCTTCGTCTGCGCCGGCTACCCGCCGCAGAGGGGCCCCGGCTGG
CAGAAGCCGGACAACAAGGCGGCCGCGGTGCCGCTCGAGTCCAAGGACCCCAGCTACGTGCCCCCCGGCGCCTAC
GGCATGCCCCAGCACGGCAGCGCCTCGTACGCGACGCAGCCGCCCGTCAAGCGCGAGCCCCTGCCGCACTACCGC
GGCCAGTCGCTCCGCATAGACCCGCCCCAGGGCCGGCCGCTGGCCATGTCCGACGACGACCGGCCGACGGCGTCG
ACGCTGGCCAGCGCATCGGCCGCCAGCCCCGACAGCAAGCTCTCGGCCATGGCCTACGGGCCCGGCGCCGTCTTC
CCGACGCCCGTCAGCGCCAACACGCAGCCGCCGCCGCCCTTCGGCGACAGGCCGCCGCCGGCCAAGGACTACCAG
CGCGTGCCGCCGCTGCACGACCTCCAGAGCCGGAGCGAGCCCGAGACGCCCCATCCGGCGAACGCGCTGCCGCAG
ATCAACATCCTCCACCCGACGCGCGCCAGCAGCCCGACGCCCCACGCGCAGCAGCAGCCACAGCAGCAGCAGCAG
CAGCCGCCGCCGCCGCCTCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCCTCGTCGTCGTCGTCGTCGAGCGCG
CAGGTGGCGGCGCAGCTGGCCCTGTCGCACCCGCAGTACCCGCAGCGGCGGACGCAAAAGGAGGAGATGCTGTCG
GGGCGGCACTTCTACCCCTTCGACAAGGAGCTGTGCCTGGAGCGCGAGCGCTGCGCCGTGGCCTGCTGGCGCTTC
AACAACCTGACGACGCCGCCGACGCACGGCGTGTCGCCCGACGAGCGGGCCCGCCTCTTCCTCGAGATCCTGCAG
CCGCGCGACCCGGTGCGGGTGTCGCCGACGGAGGCGTCGCCCGTGACCAACGTCGGGCGCGTCGGGCGGCACGTG
GCCGTCGAGACGCCCTTCACCTGCGACTACGGCTACAACATCTCGATCGGGCACCACGTCGTCCTCGGCCGCAAC
TGCACCATCAACGACGTGTGCGAGGTCAAGATCGGCGACAACTGCGTCGTCGGGCCCAACGTCAGCATCTTCACG
GCCACGCTGCCCATCGACCCCAAGAAGCGCCAGGGCGGCCAGGGCCCGCAGCAGGGCAGGGCCATCACCATCGAG
CAGGACTGCTGGATCGGCGGCGGCGCCATCATCCTGCCGGGCCGGACCATCGGCAAGGGGAGCACCGTCGGGGCC
GGCTCCATCGTGACCAAGGACGTGCCCCCCTTCACCGTCGTGGCCGGCAACCCGGCGCGCGTCCTCCGCGGCATC
GGCATCGCGCCCTGA
Transcript >Hirsu2|6647
ATGTCCACCTTCACCGCCCTCAATGGGACCTCACCCAAGACGACCGATCCGCCGCCGCATCCCAAGAGCAGCGGC
ACCTCGGCCGACAAGGCCGGCCTCGACGACCCCTCCCTAGGCCCGGCCGCCTTCCGGCCCCGGAAGTCGCCTGAT
GCCTCCGCCGCCGCCGCCGCCGCCCTCCACAAGGAGTCGTGGCGCGGCCAGGACCGGCACCCATTCCCGCCCGCC
AGCTACCCCGACGCCGAGGCCTCCCACAAGCGCAAGCGCTCGCCCTCGCCCTCGCTCGACCTGAGGCGCGAGCCT
TCCGCCCGCCAATCGACGCCCGAGACGGCGCCGGCGCCCGACACGCGCGCCTCTCGTGCCACGCCCCAGCGCGAC
TTCCGCCACTGCAGCGACGATCAGCGCGACGGCGACTCGTCCTCCTGGCAGTCCCTCCAGGGCCGCGACGACAGG
GGCCCGTACGACGGCCAGCACGGCTCCGCCACCTCGGCCTCGGCCCACGCCGACGACCAGATGGGCGACGCCCTG
CGCAGGGCCGCCGCCCAGGGCCAGATGGACCACAGCGACTACAGCCACACGAGCCCCGACGCCGAGGACAGGTCC
GCCCCCGTCTACGGCAGTCCCTACGGGCCCGACCACCGTCAGGATTCCGTCCCCCAGCACGACCCCAAGAAGCGG
AAGCGCAACTTCAGCAACCGCACCAAGACGGGCTGCCTCACCTGTCGCAAGCGCAAGAAGAAGTGCGACGAGCAC
AAGCCCGAGTGCAGCAACTGCATCCGAGGCGGCTTCGTCTGCGCCGGCTACCCGCCGCAGAGGGGCCCCGGCTGG
CAGAAGCCGGACAACAAGGCGGCCGCGGTGCCGCTCGAGTCCAAGGACCCCAGCTACGTGCCCCCCGGCGCCTAC
GGCATGCCCCAGCACGGCAGCGCCTCGTACGCGACGCAGCCGCCCGTCAAGCGCGAGCCCCTGCCGCACTACCGC
GGCCAGTCGCTCCGCATAGACCCGCCCCAGGGCCGGCCGCTGGCCATGTCCGACGACGACCGGCCGACGGCGTCG
ACGCTGGCCAGCGCATCGGCCGCCAGCCCCGACAGCAAGCTCTCGGCCATGGCCTACGGGCCCGGCGCCGTCTTC
CCGACGCCCGTCAGCGCCAACACGCAGCCGCCGCCGCCCTTCGGCGACAGGCCGCCGCCGGCCAAGGACTACCAG
CGCGTGCCGCCGCTGCACGACCTCCAGAGCCGGAGCGAGCCCGAGACGCCCCATCCGGCGAACGCGCTGCCGCAG
ATCAACATCCTCCACCCGACGCGCGCCAGCAGCCCGACGCCCCACGCGCAGCAGCAGCCACAGCAGCAGCAGCAG
CAGCCGCCGCCGCCGCCTCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCCTCGTCGTCGTCGTCGTCGAGCGCG
CAGGTGGCGGCGCAGCTGGCCCTGTCGCACCCGCAGTACCCGCAGCGGCGGACGCAAAAGGAGGAGATGCTGTCG
GGGCGGCACTTCTACCCCTTCGACAAGGAGCTGTGCCTGGAGCGCGAGCGCTGCGCCGTGGCCTGCTGGCGCTTC
AACAACCTGACGACGCCGCCGACGCACGGCGTGTCGCCCGACGAGCGGGCCCGCCTCTTCCTCGAGATCCTGCAG
CCGCGCGACCCGGTGCGGGTGTCGCCGACGGAGGCGTCGCCCGTGACCAACGTCGGGCGCGTCGGGCGGCACGTG
GCCGTCGAGACGCCCTTCACCTGCGACTACGGCTACAACATCTCGATCGGGCACCACGTCGTCCTCGGCCGCAAC
TGCACCATCAACGACGTGTGCGAGGTCAAGATCGGCGACAACTGCGTCGTCGGGCCCAACGTCAGCATCTTCACG
GCCACGCTGCCCATCGACCCCAAGAAGCGCCAGGGCGGCCAGGGCCCGCAGCAGGGCAGGGCCATCACCATCGAG
CAGGACTGCTGGATCGGCGGCGGCGCCATCATCCTGCCGGGCCGGACCATCGGCAAGGGGAGCACCGTCGGGGCC
GGCTCCATCGTGACCAAGGACGTGCCCCCCTTCACCGTCGTGGCCGGCAACCCGGCGCGCGTCCTCCGCGGCATC
GGCATCGCGCCCTGA
Gene >Hirsu2|6647
ATGTCCACCTTCACCGCCCTCAATGGGACCTCACCCAAGACGACCGATCCGCCGCCGCATCCCAAGAGCAGCGGC
ACCTCGGCCGACAAGGCCGGCCTCGACGACCCCTCCCTAGGCCCGGCCGCCTTCCGGCCCCGGAAGTCGCCTGAT
GCCTCCGCCGCCGCCGCCGCCGCCCTCCACAAGGAGTCGTGGCGCGGCCAGGACCGGCACCCATTCCCGCCCGCC
AGCTACCCCGACGCCGAGGCCTCCCACAAGCGCAAGCGCTCGCCCTCGCCCTCGCTCGACCTGAGGCGCGAGCCT
TCCGCCCGCCAATCGACGCCCGAGACGGCGCCGGCGCCCGACACGCGCGCCTCTCGTGCCACGCCCCAGCGCGAC
TTCCGCCACTGCAGCGACGATCAGCGCGACGGCGACTCGTCCTCCTGGCAGTCCCTCCAGGGCCGCGACGACAGG
GGCCCGTACGACGGCCAGCACGGCTCCGCCACCTCGGCCTCGGCCCACGCCGACGACCAGATGGGCGACGCCCTG
CGCAGGGCCGCCGCCCAGGGCCAGATGGACCACAGCGACTACAGCCACACGAGCCCCGACGCCGAGGACAGGTCC
GCCCCCGTCTACGGCAGTCCCTACGGGCCCGACCACCGTCAGGATTCCGTCCCCCAGCACGACCCCAAGAAGCGG
AAGCGCAACTTCAGCAACCGCACCAAGACGGGCTGCCTCACCTGTCGCAAGCGCAAGAAGAAGTGCGACGAGCAC
AAGCCCGAGTGTTAGCGCCCCCCTCCCTTTTTTTCTTCTGACACACGCGGCACCCCAAAAAATCGGTAAGTGGTA
GCAGTAGCAGCAGACGCTGACGCCCGCGCTCGCAGGCAGCAACTGCATCCGAGGCGGCTTCGTCTGCGCCGGCTA
CCCGCCGCAGAGGGGCCCCGGCTGGCAGAAGCCGGACAACAAGGCGGCCGCGGTGCCGCTCGAGTCCAAGGACCC
CAGCTACGTGCCCCCCGGCGCCTACGGCATGCCCCAGCACGGCAGCGCCTCGTACGCGACGCAGCCGCCCGTCAA
GCGCGAGCCCCTGCCGCACTACCGCGGCCAGTCGCTCCGCATAGACCCGCCCCAGGGCCGGCCGCTGGCCATGTC
CGACGACGACCGGCCGACGGCGTCGACGCTGGCCAGCGCATCGGCCGCCAGCCCCGACAGCAAGCTCTCGGCCAT
GGCCTACGGGCCCGGCGCCGTCTTCCCGACGCCCGTCAGCGCCAACACGCAGCCGCCGCCGCCCTTCGGCGACAG
GCCGCCGCCGGCCAAGGACTACCAGCGCGTGCCGCCGCTGCACGACCTCCAGAGCCGGAGCGAGCCCGAGACGCC
CCATCCGGCGAACGCGCTGCCGCAGATCAACATCCTCCACCCGACGCGCGCCAGCAGCCCGACGCCCCACGCGCA
GCAGCAGCCACAGCAGCAGCAGCAGCAGCCGCCGCCGCCGCCTCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCC
CTCGTCGTCGTCGTCGTCGAGCGCGCAGGTGGCGGCGCAGCTGGCCCTGTCGCACCCGCAGTACCCGCAGCGGCG
GACGCAAAAGGAGGAGATGCTGTCGGGGCGGCACTTCTACCCCTTCGACAAGGAGCTGTGCCTGGAGCGCGAGCG
CTGCGCCGTGGCCTGCTGGCGCTTCAACAACCTGACGACGCCGCCGACGCACGGCGTGTCGCCCGACGAGCGGGC
CCGCCTCTTCCTCGAGATCCTGCAGCCGCGCGACCCGGTGCGGGTGTCGCCGACGGAGGCGTCGCCCGTGACCAA
CGTCGGGCGCGTCGGGCGGCACGTGGCCGTCGAGACGCCCTTCACCTGCGACTACGGCTACAACATCTCGATCGG
GCACCACGTCGTCCTCGGCCGCAACTGCACCATCAACGACGTGTGCGAGGTCAAGATCGGCGACAACTGCGTCGT
CGGGCCCAACGTCAGCATCTTCACGGCCACGCTGCCCATCGACCCCAAGAAGCGCCAGGGCGGCCAGGGCCCGCA
GCAGGGCAGGGCCATCACCATCGAGCAGGACTGCTGGATCGGCGGCGGCGCCATCATCCTGCCGGGCCGGACCAT
CGGCAAGGGGAGCACCGTCGGGGCCGGCTCCATCGTGACCAAGGTAAGGCCCGCCTGTTTGCCGTTGCAAAGGAG
TGGCTTTTGCGCCTCGGCCGCTGACACCCCGTCACCCTTCCTGCAGGACGTGCCCCCCTTCACCGTCGTGGCCGG
CAACCCGGCGCGCGTCCTCCGCGGCATCGGCATCGCGCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail