Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6644
Gene name
LocationContig_347:13594..14172
Strand+
Gene length (bp)578
Transcript length (bp)462
Coding sequence length (bp)462
Protein length (aa) 154

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13917 zf-CCHC_3 Zinc knuckle 9.1E-11 18 45

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4162 0.7816 0.1563 0.0457 0.0448 0.0053 0.075 0.0437 0.0261 0.0062

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5498
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1488
Ophiocordyceps australis map64 (Brazil) OphauB2|4992
Ophiocordyceps camponoti-floridani Ophcf2|02135
Ophiocordyceps camponoti-rufipedis Ophun1|6904
Ophiocordyceps kimflemingae Ophio5|2168
Ophiocordyceps subramaniannii Hirsu2|6644 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6644
MYAESDDEYMQLTIESRHYSYECKASSQERPYVSRPSRSQQLRNPKLVPKLTNNALEPLEAKKGVADAEIAKRQA
ERTRKRDLEDREDKAELPPKQTTKEPDQVSDTGKAQAQPRICAQHRETTTTWSQLQSRLQSTQRRETTMAWSQLQ
SRL*
Coding >Hirsu2|6644
ATGTATGCCGAATCCGACGATGAGTACATGCAGCTGACTATCGAATCACGTCACTATTCATACGAGTGCAAAGCT
TCATCGCAAGAGCGGCCATATGTCTCGCGTCCTTCCCGCTCCCAGCAACTACGTAACCCCAAGCTCGTACCAAAG
CTCACCAACAACGCATTGGAACCTTTGGAAGCAAAGAAAGGCGTGGCCGATGCGGAAATCGCCAAGAGGCAAGCT
GAGCGGACGAGGAAGCGCGATCTCGAAGACCGTGAGGACAAGGCCGAGCTTCCGCCCAAACAGACGACCAAGGAG
CCGGACCAGGTCTCCGACACCGGTAAGGCACAGGCACAGCCCAGGATCTGCGCACAGCATCGAGAGACGACCACG
ACCTGGTCGCAGCTACAGTCGCGGCTCCAGTCCACGCAGCGTCGAGAGACGACCATGGCGTGGTCGCAACTGCAG
TCGCGGCTCTAG
Transcript >Hirsu2|6644
ATGTATGCCGAATCCGACGATGAGTACATGCAGCTGACTATCGAATCACGTCACTATTCATACGAGTGCAAAGCT
TCATCGCAAGAGCGGCCATATGTCTCGCGTCCTTCCCGCTCCCAGCAACTACGTAACCCCAAGCTCGTACCAAAG
CTCACCAACAACGCATTGGAACCTTTGGAAGCAAAGAAAGGCGTGGCCGATGCGGAAATCGCCAAGAGGCAAGCT
GAGCGGACGAGGAAGCGCGATCTCGAAGACCGTGAGGACAAGGCCGAGCTTCCGCCCAAACAGACGACCAAGGAG
CCGGACCAGGTCTCCGACACCGGTAAGGCACAGGCACAGCCCAGGATCTGCGCACAGCATCGAGAGACGACCACG
ACCTGGTCGCAGCTACAGTCGCGGCTCCAGTCCACGCAGCGTCGAGAGACGACCATGGCGTGGTCGCAACTGCAG
TCGCGGCTCTAG
Gene >Hirsu2|6644
ATGTATGCCGAATCCGACGATGAGTACATGCAGCTGACTATCGAATCACGTCACTATTCATACGAGTGCAAAGCT
TCATCGCAAGAGCGGCCATATGTCTCGCGTCCTTCCCGCTCCCAGCAACTACGTAACCCCAAGCTCGTACCAAAG
CTCACCAACAACGCATTGGAACCTTTGGAAGCAAAGTACGTACGAGTAATCAAGTGTCCCAACCGCTGGGTTGTT
CTGACTCGACGCAGGAAAGGCGTGGCCGATGCGGAAATCGCCAAGAGGCAAGCTGAGCGGACGAGGAAGCGCGAT
CTCGAAGACCGTGAGGACAAGGCCGAGCTTCCGCCCAAACGTCCAAGATCCATTTCTAGAAGCTCAGTGTCGACC
AATTCGACGGACTTTGCTGCAAACGAGAGACGACCAAGGAGCCGGACCAGGTCTCCGACACCGGTAAGGCACAGG
CACAGCCCAGGATCTGCGCACAGCATCGAGAGACGACCACGACCTGGTCGCAGCTACAGTCGCGGCTCCAGTCCA
CGCAGCGTCGAGAGACGACCATGGCGTGGTCGCAACTGCAGTCGCGGCTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail