Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6643
Gene name
LocationContig_347:10011..12265
Strand-
Gene length (bp)2254
Transcript length (bp)1749
Coding sequence length (bp)1749
Protein length (aa) 583

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12752 SUZ SUZ domain 3.7E-15 343 408
PF01424 R3H R3H domain 4.6E-08 279 323

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q15032|R3HD1_HUMAN R3H domain-containing protein 1 OS=Homo sapiens GN=R3HDM1 PE=1 SV=3 265 414 5.0E-14
sp|Q80TM6|R3HD2_MOUSE R3H domain-containing protein 2 OS=Mus musculus GN=R3hdm2 PE=1 SV=2 265 404 8.0E-13
sp|A0JNC2|R3HD2_BOVIN R3H domain-containing protein 2 OS=Bos taurus GN=R3HDM2 PE=2 SV=1 265 405 1.0E-12
sp|Q9UBL0|ARP21_HUMAN cAMP-regulated phosphoprotein 21 OS=Homo sapiens GN=ARPP21 PE=1 SV=2 265 468 2.0E-12
sp|Q9DCB4|ARP21_MOUSE cAMP-regulated phosphoprotein 21 OS=Mus musculus GN=Arpp21 PE=1 SV=2 267 468 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q15032|R3HD1_HUMAN R3H domain-containing protein 1 OS=Homo sapiens GN=R3HDM1 PE=1 SV=3 265 414 5.0E-14
sp|Q80TM6|R3HD2_MOUSE R3H domain-containing protein 2 OS=Mus musculus GN=R3hdm2 PE=1 SV=2 265 404 8.0E-13
sp|A0JNC2|R3HD2_BOVIN R3H domain-containing protein 2 OS=Bos taurus GN=R3HDM2 PE=2 SV=1 265 405 1.0E-12
sp|Q9UBL0|ARP21_HUMAN cAMP-regulated phosphoprotein 21 OS=Homo sapiens GN=ARPP21 PE=1 SV=2 265 468 2.0E-12
sp|Q9DCB4|ARP21_MOUSE cAMP-regulated phosphoprotein 21 OS=Mus musculus GN=Arpp21 PE=1 SV=2 267 468 1.0E-11
sp|Q8MSX1|ENC_DROME Protein encore OS=Drosophila melanogaster GN=enc PE=1 SV=2 250 404 9.0E-10
sp|Q9Y2K5|R3HD2_HUMAN R3H domain-containing protein 2 OS=Homo sapiens GN=R3HDM2 PE=1 SV=3 265 326 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6643
MATAQVSSDLPRPSFAKVAAAVSKEPSSGPSSASDQAATSKNQHGAAGPIVVSGASANATLPPRNPLPAQSAGQG
TVRGNPAVTDKVVASLNDLKLAPKVPHFVVDGSGVALERQRPLVSRESVSDESQKCDSSSELGTKPPSLDGKSIT
SGTTFALDEKESLRPDDSASVKAAAEDDDAFSIRGSFIAGSRMGSEVAAKARGIQLGDIPERRLVQQPLGTPGHG
VLTPQSSTSERPPPANPTMPLSAEGSSDALNVIYRQAPDEKLLDALASPRDRYFLLRLEKDVIDFVQDSKEPYMD
LPPSNSFCRMLTHKLADYYHMTHSYEPHIGASTASTPPPAVLPKKIMRRGQDGEGGPVSAGASKPTSESGSDNKD
GKEKQPMAKEKLSREEREEIYKLARERIFGSAEEVVQENDGENGMSRTSSVSATNKVATNKRGKTGKQRRDDSDS
FDSRYQYTPYWGPQQQTWVPQPQGQFLPPAHGQFNSQPLHAYPGQTTAAYGQQPAAYPGVSCMPPPPPPPPPPPP
NPNYQAYGMPQGPPQHPQQRYQPGMAAGLQCAGLPTESTGTPSIAGSKPASHPRKLQ*
Coding >Hirsu2|6643
ATGGCGACCGCACAGGTATCTTCGGATCTCCCACGGCCTTCCTTTGCCAAGGTGGCCGCCGCTGTTTCAAAAGAG
CCTTCATCGGGTCCATCTTCCGCCAGCGACCAGGCTGCAACTTCCAAAAACCAGCATGGAGCCGCCGGCCCCATT
GTCGTCAGCGGTGCCTCAGCAAATGCCACTCTCCCGCCGCGAAACCCCTTGCCTGCCCAATCCGCGGGCCAAGGT
ACAGTCAGGGGCAATCCTGCCGTCACGGACAAAGTGGTAGCGTCGCTGAATGACCTGAAGCTCGCACCCAAGGTT
CCTCACTTTGTCGTCGACGGGTCTGGCGTCGCGCTGGAACGCCAACGCCCACTGGTCAGCAGGGAGAGCGTATCG
GACGAATCGCAGAAATGTGACTCGAGCTCCGAGCTGGGGACCAAGCCCCCCAGCTTGGACGGCAAGAGCATCACC
TCCGGGACCACCTTTGCCCTGGACGAAAAGGAATCGCTTCGTCCCGACGATAGTGCAAGCGTTAAGGCCGCTGCC
GAGGACGACGACGCCTTCTCTATCCGAGGCTCCTTCATTGCCGGCTCTCGCATGGGCTCCGAGGTCGCCGCCAAA
GCCCGCGGCATTCAGCTGGGAGACATACCCGAGCGCAGGCTGGTGCAGCAACCCCTCGGGACCCCTGGACACGGC
GTGTTGACGCCCCAGAGTTCGACTTCTGAGCGACCGCCGCCCGCCAATCCCACGATGCCACTGAGCGCCGAGGGC
TCGTCGGATGCTCTCAATGTCATCTATCGGCAGGCCCCGGACGAGAAGCTTCTCGATGCCCTTGCCAGCCCCAGA
GATCGATATTTTCTGCTAAGATTGGAGAAGGATGTTATCGATTTTGTACAGGATTCCAAGGAACCGTACATGGAC
TTGCCACCGTCGAATTCGTTCTGTCGCATGTTAACGCATAAGCTGGCCGACTACTACCACATGACACACTCTTAC
GAGCCACATATCGGCGCTTCCACCGCCAGCACTCCGCCGCCCGCCGTTCTTCCCAAAAAGATCATGCGCCGTGGG
CAAGACGGGGAGGGTGGACCGGTGAGCGCCGGCGCCTCGAAGCCTACGTCCGAGTCTGGAAGCGACAACAAGGAC
GGCAAAGAGAAACAGCCAATGGCGAAAGAGAAACTATCGAGAGAAGAGAGAGAGGAGATATACAAGTTGGCTCGG
GAGCGCATATTCGGCAGCGCGGAAGAAGTCGTTCAAGAAAACGACGGCGAGAATGGAATGTCTCGCACGAGCTCT
GTCTCTGCCACTAACAAAGTTGCCACCAATAAACGTGGCAAGACTGGTAAACAGCGACGCGATGACTCGGACAGC
TTTGACTCCAGGTACCAGTATACTCCTTACTGGGGCCCGCAGCAGCAGACCTGGGTGCCTCAACCTCAAGGGCAG
TTCCTGCCTCCAGCTCACGGCCAATTCAACAGCCAGCCACTGCATGCGTATCCTGGACAGACCACGGCCGCGTAC
GGCCAGCAGCCAGCCGCCTACCCCGGCGTGTCCTGCATGCCGCCGCCGCCGCCGCCGCCTCCTCCTCCTCCTCCC
AACCCGAACTACCAAGCCTACGGCATGCCCCAGGGTCCGCCGCAACACCCTCAACAGCGCTATCAACCCGGGATG
GCAGCCGGGCTTCAATGCGCCGGCCTACCCACCGAGAGCACCGGCACCCCCAGCATCGCAGGGTCAAAGCCAGCA
TCCCATCCCCGGAAGCTACAGTAG
Transcript >Hirsu2|6643
ATGGCGACCGCACAGGTATCTTCGGATCTCCCACGGCCTTCCTTTGCCAAGGTGGCCGCCGCTGTTTCAAAAGAG
CCTTCATCGGGTCCATCTTCCGCCAGCGACCAGGCTGCAACTTCCAAAAACCAGCATGGAGCCGCCGGCCCCATT
GTCGTCAGCGGTGCCTCAGCAAATGCCACTCTCCCGCCGCGAAACCCCTTGCCTGCCCAATCCGCGGGCCAAGGT
ACAGTCAGGGGCAATCCTGCCGTCACGGACAAAGTGGTAGCGTCGCTGAATGACCTGAAGCTCGCACCCAAGGTT
CCTCACTTTGTCGTCGACGGGTCTGGCGTCGCGCTGGAACGCCAACGCCCACTGGTCAGCAGGGAGAGCGTATCG
GACGAATCGCAGAAATGTGACTCGAGCTCCGAGCTGGGGACCAAGCCCCCCAGCTTGGACGGCAAGAGCATCACC
TCCGGGACCACCTTTGCCCTGGACGAAAAGGAATCGCTTCGTCCCGACGATAGTGCAAGCGTTAAGGCCGCTGCC
GAGGACGACGACGCCTTCTCTATCCGAGGCTCCTTCATTGCCGGCTCTCGCATGGGCTCCGAGGTCGCCGCCAAA
GCCCGCGGCATTCAGCTGGGAGACATACCCGAGCGCAGGCTGGTGCAGCAACCCCTCGGGACCCCTGGACACGGC
GTGTTGACGCCCCAGAGTTCGACTTCTGAGCGACCGCCGCCCGCCAATCCCACGATGCCACTGAGCGCCGAGGGC
TCGTCGGATGCTCTCAATGTCATCTATCGGCAGGCCCCGGACGAGAAGCTTCTCGATGCCCTTGCCAGCCCCAGA
GATCGATATTTTCTGCTAAGATTGGAGAAGGATGTTATCGATTTTGTACAGGATTCCAAGGAACCGTACATGGAC
TTGCCACCGTCGAATTCGTTCTGTCGCATGTTAACGCATAAGCTGGCCGACTACTACCACATGACACACTCTTAC
GAGCCACATATCGGCGCTTCCACCGCCAGCACTCCGCCGCCCGCCGTTCTTCCCAAAAAGATCATGCGCCGTGGG
CAAGACGGGGAGGGTGGACCGGTGAGCGCCGGCGCCTCGAAGCCTACGTCCGAGTCTGGAAGCGACAACAAGGAC
GGCAAAGAGAAACAGCCAATGGCGAAAGAGAAACTATCGAGAGAAGAGAGAGAGGAGATATACAAGTTGGCTCGG
GAGCGCATATTCGGCAGCGCGGAAGAAGTCGTTCAAGAAAACGACGGCGAGAATGGAATGTCTCGCACGAGCTCT
GTCTCTGCCACTAACAAAGTTGCCACCAATAAACGTGGCAAGACTGGTAAACAGCGACGCGATGACTCGGACAGC
TTTGACTCCAGGTACCAGTATACTCCTTACTGGGGCCCGCAGCAGCAGACCTGGGTGCCTCAACCTCAAGGGCAG
TTCCTGCCTCCAGCTCACGGCCAATTCAACAGCCAGCCACTGCATGCGTATCCTGGACAGACCACGGCCGCGTAC
GGCCAGCAGCCAGCCGCCTACCCCGGCGTGTCCTGCATGCCGCCGCCGCCGCCGCCGCCTCCTCCTCCTCCTCCC
AACCCGAACTACCAAGCCTACGGCATGCCCCAGGGTCCGCCGCAACACCCTCAACAGCGCTATCAACCCGGGATG
GCAGCCGGGCTTCAATGCGCCGGCCTACCCACCGAGAGCACCGGCACCCCCAGCATCGCAGGGTCAAAGCCAGCA
TCCCATCCCCGGAAGCTACAGTAG
Gene >Hirsu2|6643
ATGGCGACCGCACAGGTATCTTCGGATCTCCCACGGCCTTCCTTTGCCAAGGTACGCGCTCTCGCCCGACGCGCC
ACCTGTTTTGCGCACTTGCTGACACTTAGTGAACCCTCCTGTACAGGTGGCCGCCGCTGTTTCAAAAGAGCCTTC
ATCGGGTCCATCTTCCGCCAGCGACCAGGCTGCAACTTCCAAAAACCAGCATGGAGCCGCCGGCCCCATTGTCGT
CAGCGGTGCCTCAGCAAATGCCACTCTCCCGCCGCGAAACCCCTTGCCTGCCCAATCCGCGGGCCAAGGTACAGT
CAGGGGCAATCCTGCCGTCACGGACAAAGTGGTAGCGTCGCTGAATGACCTGAAGCTCGCACCCAAGGTTCCTCA
CTTTGTCGTCGACGGGTCTGGCGTCGCGCTGGAACGCCAACGCCCACTGGTCAGCAGGGAGAGCGTATCGGACGA
ATCGCAGAAATGTGACTCGAGCTCCGAGCTGGGGACCAAGCCCCCCAGCTTGGACGGCAAGAGCATCACCTCCGG
GACCACCTTTGCCCTGGACGAAAAGGAATCGCTTCGTCCCGACGATAGTGCAAGCGTTAAGGCCGCTGCCGAGGA
CGACGACGCCTTCTCTATCCGAGGCTCCTTCATTGCCGGCTCTCGCATGGGCTCCGAGGTCGCCGCCAAAGCCCG
CGGCATTCAGCTGGGAGACATACCCGAGCGCAGGCTGGTGCAGCAACCCCTCGGGACCCCTGGACACGGCGTGTT
GACGCCCCAGAGTTCGACTTCTGAGCGACCGCCGCCCGCCAATCCCACGATGCCACTGAGCGCCGAGGGCTCGTC
GGATGCTCTCAATGTCATCTATCGGCAGGCCCCGGACGAGAAGCTTCTCGATGCCCTTGCCAGCCCCAGAGATCG
ATATTTTCTGCTAAGATTGGAGAAGGATGTTATCGATTTTGTACAGGATTCCAAGTATGTTGAGCTTCGGCCTCT
GTTTCGGCCTCTCTCCACCTCGTCCTCGGCCCCGAGCCCCTGTTCTAACACTCCCAGGGAACCGTACATGGACTT
GCCACCGTCGAATTCGTTCTGTCGCATGTTAACGCATAAGCTGGCCGACTACTACCACATGACACACTCTTACGA
GCCACATATCGGGTCCGTCCGCATATTCCGAACGCCATTCTGTCGGGTCCCTCCGTCTCTGGCAACCATGGCGCC
GCAACCCAGCGCTTCCACCGCCAGCACTCCGCCGCCCGCCGTTCTTCCCAAAAAGATCATGCGCCGTGGGCAAGA
CGGGGAGGGTGGACCGGTGAGCGCCGGCGCCTCGAAGCCTACGTCCGAGTCTGGAAGCGACAACAAGGACGGCAA
AGAGAAACAGCCAATGGCGAAAGAGAAGTCAGCGCACTTTGCGCACTGTTGAGAAGTCTCGGCCTGCTGACATAT
CGCATCAGACTATCGAGAGAAGAGAGAGAGGAGATATACAAGTTGGCTCGGGAGCGCATATTCGGCAGCGCGGAA
GAAGTCGTTCAAGGTATGTCGCCGCGCGCAAAAAGGTCAGACGTCTGCCCACCGCGACTGACACACGTGTAGAAA
ACGACGGCGAGAATGGAATGTCTCGCACGAGCTCTGTCTCTGCCACTAACAAAGTTGCCACCAATAAACGTGGCA
AGACTGGTAAACAGCGACGCGATGACTCGGACAGCTTTGACTCCAGGTACCAGTATACTCCTTACTGGGGCCCGC
AGCAGCAGACCTGGGTGCCTCAACCTCAAGGGCAGTTCCTGCCTCCAGCTCACGGCCAATTCAACAGCCAGCCAC
TGCATGCGTATCCTGGACAGACCACGGCCGCGTACGGCCAGCAGCCAGCCGCCTACCCCGGCGTGTCCTGCATGC
CGCCGCCGCCGCCGCCGCCTCCTCCTCCTCCTCCCAACCCGAACTACCAAGCCTACGGCATGCCCCAGGTGAGCG
GTGTTCACGGTGCTTCCCCGTGCTCGCGACTGACGACTGGCGCGCAGGGTCCGCCGCAACACCCTCAACAGCGCT
ATCAACCCGGTGGCAGCCCGATGACGGCCTACGGCTCCCCGGTGCCTCCGCCCGCTGTGCCGCAGGGATGGCAGC
CGGGCTTCAATGCGCCGGCCTACCCACCGAGAGCACCGGCACCCCCAGCATCGCAGGGTCAAGTAGGCATTCCGT
ATGCCTACGGGCAGCTCCCTGCGAATGCTAACCCGAACGATCCAAAGAGCCAGCATCCCATCCCCGGAAGCTACA
GTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail