Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6635
Gene name
LocationContig_346:13288..14872
Strand-
Gene length (bp)1584
Transcript length (bp)1230
Coding sequence length (bp)1230
Protein length (aa) 410

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00647 EF1G Elongation factor 1 gamma, conserved domain 1.1E-43 247 352
PF00043 GST_C Glutathione S-transferase, C-terminal domain 4.5E-14 103 196
PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain 3.0E-08 126 190
PF02798 GST_N Glutathione S-transferase, N-terminal domain 9.0E-08 4 74
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 1.8E-06 125 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29547|EF1G1_YEAST Elongation factor 1-gamma 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAM1 PE=1 SV=2 1 409 2.0E-104
sp|P36008|EF1G2_YEAST Elongation factor 1-gamma 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEF4 PE=1 SV=1 1 409 1.0E-99
sp|P40921|EF1G_SCHPO Elongation factor 1-gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef3 PE=1 SV=1 1 409 3.0E-82
sp|P26641|EF1G_HUMAN Elongation factor 1-gamma OS=Homo sapiens GN=EEF1G PE=1 SV=3 1 409 4.0E-77
sp|Q4R7H5|EF1G_MACFA Elongation factor 1-gamma OS=Macaca fascicularis GN=EEF1G PE=2 SV=1 1 409 2.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29547|EF1G1_YEAST Elongation factor 1-gamma 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAM1 PE=1 SV=2 1 409 2.0E-104
sp|P36008|EF1G2_YEAST Elongation factor 1-gamma 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEF4 PE=1 SV=1 1 409 1.0E-99
sp|P40921|EF1G_SCHPO Elongation factor 1-gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef3 PE=1 SV=1 1 409 3.0E-82
sp|P26641|EF1G_HUMAN Elongation factor 1-gamma OS=Homo sapiens GN=EEF1G PE=1 SV=3 1 409 4.0E-77
sp|Q4R7H5|EF1G_MACFA Elongation factor 1-gamma OS=Macaca fascicularis GN=EEF1G PE=2 SV=1 1 409 2.0E-76
sp|A2Q127|EF1G_HORSE Elongation factor 1-gamma OS=Equus caballus GN=EEF1G PE=2 SV=1 1 409 5.0E-76
sp|P29694|EF1G_RABIT Elongation factor 1-gamma OS=Oryctolagus cuniculus GN=EEF1G PE=2 SV=3 1 409 9.0E-76
sp|Q9D8N0|EF1G_MOUSE Elongation factor 1-gamma OS=Mus musculus GN=Eef1g PE=1 SV=3 1 409 9.0E-76
sp|Q68FR6|EF1G_RAT Elongation factor 1-gamma OS=Rattus norvegicus GN=Eef1g PE=2 SV=3 1 409 1.0E-75
sp|Q29387|EF1G_PIG Elongation factor 1-gamma (Fragment) OS=Sus scrofa GN=EEF1G PE=2 SV=2 6 409 5.0E-74
sp|Q3SZV3|EF1G_BOVIN Elongation factor 1-gamma OS=Bos taurus GN=EEF1G PE=2 SV=1 1 409 3.0E-73
sp|P12261|EF1G_ARTSA Elongation factor 1-gamma OS=Artemia salina PE=1 SV=3 1 409 3.0E-72
sp|Q6PE25|EF1G_DANRE Elongation factor 1-gamma OS=Danio rerio GN=eef1g PE=2 SV=1 1 409 2.0E-71
sp|P26642|EF1GA_XENLA Elongation factor 1-gamma-A OS=Xenopus laevis GN=eef1g-a PE=1 SV=1 1 409 3.0E-69
sp|Q90YC0|EF1G_CARAU Elongation factor 1-gamma OS=Carassius auratus GN=eef1g PE=2 SV=1 1 409 4.0E-69
sp|Q91375|EF1GB_XENLA Elongation factor 1-gamma-B OS=Xenopus laevis GN=eef1g-b PE=2 SV=1 1 409 6.0E-66
sp|Q5Z627|EF1G3_ORYSJ Elongation factor 1-gamma 3 OS=Oryza sativa subsp. japonica GN=Os06g0571400 PE=2 SV=1 17 373 1.0E-57
sp|P54412|EF1G_CAEEL Probable elongation factor 1-gamma OS=Caenorhabditis elegans GN=eef-1G PE=3 SV=1 4 409 8.0E-56
sp|Q00717|STCT_EMENI Putative sterigmatocystin biosynthesis protein stcT OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcT PE=4 SV=1 1 205 1.0E-55
sp|O04487|EF1G1_ARATH Probable elongation factor 1-gamma 1 OS=Arabidopsis thaliana GN=At1g09640 PE=2 SV=1 16 373 2.0E-55
sp|Q9NJH0|EF1G_DROME Elongation factor 1-gamma OS=Drosophila melanogaster GN=Ef1gamma PE=2 SV=2 1 409 3.0E-55
sp|Q6YW46|EF1G2_ORYSJ Elongation factor 1-gamma 2 OS=Oryza sativa subsp. japonica GN=Os02g0220500 PE=2 SV=2 6 373 2.0E-54
sp|Q9FUM1|EF1G_PRUAV Elongation factor 1-gamma OS=Prunus avium PE=2 SV=1 33 373 2.0E-52
sp|Q9ZRI7|EF1G1_ORYSJ Elongation factor 1-gamma 1 OS=Oryza sativa subsp. japonica GN=Os02g0220600 PE=2 SV=1 42 373 5.0E-50
sp|Q9FVT2|EF1G2_ARATH Probable elongation factor 1-gamma 2 OS=Arabidopsis thaliana GN=At1g57720 PE=2 SV=1 17 373 7.0E-50
sp|B5BP46|YP52_SCHPO Putative glutathione S-transferase C1183.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.02c PE=3 SV=1 1 218 8.0E-30
sp|O74830|YC12_SCHPO Putative glutathione S-transferase C1183.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1183.02 PE=3 SV=1 1 204 4.0E-27
sp|P42936|YG4D_YEAST Putative elongation factor 1 gamma homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR201C PE=4 SV=3 1 198 5.0E-24
sp|P34715|EF1G_TRYCR Elongation factor 1-gamma OS=Trypanosoma cruzi PE=2 SV=1 27 394 9.0E-24
sp|P30102|GSTY2_PICKU Glutathione S-transferase Y-2 OS=Pichia kudriavzevii GN=GSTY2 PE=1 SV=2 1 197 2.0E-17
sp|P49696|SYVC_TAKRU Valine--tRNA ligase OS=Takifugu rubripes GN=vars PE=3 SV=1 84 223 3.0E-13
sp|Q9Z1Q9|SYVC_MOUSE Valine--tRNA ligase OS=Mus musculus GN=Vars PE=1 SV=1 83 239 3.0E-12
sp|Q04462|SYVC_RAT Valine--tRNA ligase OS=Rattus norvegicus GN=Vars PE=2 SV=2 83 239 4.0E-12
sp|P26640|SYVC_HUMAN Valine--tRNA ligase OS=Homo sapiens GN=VARS PE=1 SV=4 83 241 4.0E-12
sp|O65857|GSTF1_ORYSJ Probable glutathione S-transferase GSTF1 OS=Oryza sativa subsp. japonica GN=GSTF1 PE=1 SV=2 26 196 1.0E-08
sp|P42761|GSTFA_ARATH Glutathione S-transferase F10 OS=Arabidopsis thaliana GN=GSTF10 PE=1 SV=3 3 160 1.0E-08
sp|P46420|GSTF4_MAIZE Glutathione S-transferase 4 OS=Zea mays GN=GST4 PE=1 SV=2 15 203 4.0E-07
sp|Q96324|GSTFB_ARATH Glutathione S-transferase F11 OS=Arabidopsis thaliana GN=GSTF11 PE=2 SV=1 10 196 1.0E-06
sp|Q9D1M4|MCA3_MOUSE Eukaryotic translation elongation factor 1 epsilon-1 OS=Mus musculus GN=Eef1e1 PE=1 SV=1 46 196 2.0E-06
sp|P70102|MCA3_CRIGR Eukaryotic translation elongation factor 1 epsilon-1 OS=Cricetulus griseus GN=EEF1E1 PE=2 SV=1 46 196 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0006414 translational elongation Yes
GO:0003746 translation elongation factor activity Yes
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0044260 cellular macromolecule metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0045182 translation regulator activity No
GO:0071704 organic substance metabolic process No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0008135 translation factor activity, RNA binding No
GO:0003723 RNA binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6635
MAFGTLFTSADNPRSTAIKAIAKANNLDLKIVEADTTKPSIEHVKANGLGKIPAFVGEDGYNLSECIAIAIYVTS
QNEKTTLLGKTKQDYASILKWMSFFNSEIVPPMGNWFLPLLGKIPYNKKSVEDASKAVLKAVGVVEKYLVRHTYL
VGERITLADLFCASLLHRGFQYFFDKQWRQEHPNTTRWYDTVVNQPIYTAVAKKPDYLEKPALTNTAPKKTEQPK
AAAPKAAAAAAAEEDEPAPAPKPKHPCEALPKASFPLDEWKRQFSNNETPDALKWFWTNVPLEEEYSIWRCDYKY
NDELTLTFMSNNLIGGFFARLEASRKYIFGSASVYGESNNSVIQGAFVIRGQKFEPVFDVAPDYESYQFTKLDPK
KAEDRAFLENMWSWEKPVVAGGKEHAHACGKVFK*
Coding >Hirsu2|6635
ATGGCCTTCGGCACGCTCTTTACCTCCGCGGACAACCCGCGCTCAACCGCCATCAAGGCGATTGCCAAGGCCAAC
AACCTTGATCTCAAGATCGTCGAGGCTGACACCACCAAGCCGAGCATTGAGCACGTCAAGGCCAATGGACTTGGC
AAGATTCCCGCCTTCGTCGGCGAGGACGGCTATAATCTATCCGAGTGCATTGCCATCGCCATCTACGTCACCTCC
CAGAACGAGAAGACGACCCTTCTGGGCAAGACCAAGCAGGATTATGCTTCGATCCTGAAGTGGATGTCGTTCTTC
AACTCCGAGATCGTCCCTCCCATGGGCAACTGGTTCCTGCCCCTCCTCGGCAAGATCCCTTACAACAAGAAGTCT
GTTGAAGACGCATCCAAGGCTGTCCTCAAGGCTGTCGGCGTCGTCGAAAAGTACCTTGTTCGCCACACGTACCTG
GTTGGTGAGCGCATCACCCTCGCCGACCTGTTCTGCGCCAGCCTGCTGCACCGTGGCTTCCAGTACTTCTTCGAC
AAGCAGTGGCGCCAGGAGCACCCCAACACCACACGTTGGTACGATACCGTCGTCAACCAGCCCATCTACACGGCT
GTGGCCAAGAAGCCCGATTACCTCGAGAAGCCCGCCTTGACCAACACTGCCCCCAAGAAGACCGAGCAGCCCAAG
GCCGCCGCCCCCAAGGCCGCTGCCGCTGCCGCCGCAGAGGAGGATGAGCCTGCTCCCGCCCCCAAGCCCAAGCAC
CCCTGTGAGGCTCTTCCCAAGGCCTCCTTCCCTCTTGACGAGTGGAAGCGGCAATTCTCCAACAACGAGACCCCC
GACGCTCTCAAGTGGTTCTGGACCAACGTTCCCCTGGAGGAAGAGTACTCCATCTGGCGTTGCGACTACAAGTAC
AACGATGAGCTCACCCTGACTTTCATGTCGAACAACCTCATCGGCGGCTTCTTTGCCCGCTTAGAGGCCTCGCGC
AAGTACATCTTCGGCAGCGCCTCTGTCTATGGCGAGAGCAACAACTCGGTTATCCAGGGTGCCTTTGTCATCCGG
GGCCAGAAGTTCGAGCCCGTCTTTGACGTTGCTCCCGACTACGAGAGCTACCAGTTCACCAAGCTGGACCCTAAG
AAGGCCGAGGACCGCGCGTTCCTTGAGAACATGTGGTCGTGGGAAAAGCCTGTTGTCGCCGGCGGCAAGGAGCAC
GCCCACGCTTGCGGCAAGGTGTTCAAATAA
Transcript >Hirsu2|6635
ATGGCCTTCGGCACGCTCTTTACCTCCGCGGACAACCCGCGCTCAACCGCCATCAAGGCGATTGCCAAGGCCAAC
AACCTTGATCTCAAGATCGTCGAGGCTGACACCACCAAGCCGAGCATTGAGCACGTCAAGGCCAATGGACTTGGC
AAGATTCCCGCCTTCGTCGGCGAGGACGGCTATAATCTATCCGAGTGCATTGCCATCGCCATCTACGTCACCTCC
CAGAACGAGAAGACGACCCTTCTGGGCAAGACCAAGCAGGATTATGCTTCGATCCTGAAGTGGATGTCGTTCTTC
AACTCCGAGATCGTCCCTCCCATGGGCAACTGGTTCCTGCCCCTCCTCGGCAAGATCCCTTACAACAAGAAGTCT
GTTGAAGACGCATCCAAGGCTGTCCTCAAGGCTGTCGGCGTCGTCGAAAAGTACCTTGTTCGCCACACGTACCTG
GTTGGTGAGCGCATCACCCTCGCCGACCTGTTCTGCGCCAGCCTGCTGCACCGTGGCTTCCAGTACTTCTTCGAC
AAGCAGTGGCGCCAGGAGCACCCCAACACCACACGTTGGTACGATACCGTCGTCAACCAGCCCATCTACACGGCT
GTGGCCAAGAAGCCCGATTACCTCGAGAAGCCCGCCTTGACCAACACTGCCCCCAAGAAGACCGAGCAGCCCAAG
GCCGCCGCCCCCAAGGCCGCTGCCGCTGCCGCCGCAGAGGAGGATGAGCCTGCTCCCGCCCCCAAGCCCAAGCAC
CCCTGTGAGGCTCTTCCCAAGGCCTCCTTCCCTCTTGACGAGTGGAAGCGGCAATTCTCCAACAACGAGACCCCC
GACGCTCTCAAGTGGTTCTGGACCAACGTTCCCCTGGAGGAAGAGTACTCCATCTGGCGTTGCGACTACAAGTAC
AACGATGAGCTCACCCTGACTTTCATGTCGAACAACCTCATCGGCGGCTTCTTTGCCCGCTTAGAGGCCTCGCGC
AAGTACATCTTCGGCAGCGCCTCTGTCTATGGCGAGAGCAACAACTCGGTTATCCAGGGTGCCTTTGTCATCCGG
GGCCAGAAGTTCGAGCCCGTCTTTGACGTTGCTCCCGACTACGAGAGCTACCAGTTCACCAAGCTGGACCCTAAG
AAGGCCGAGGACCGCGCGTTCCTTGAGAACATGTGGTCGTGGGAAAAGCCTGTTGTCGCCGGCGGCAAGGAGCAC
GCCCACGCTTGCGGCAAGGTGTTCAAATAA
Gene >Hirsu2|6635
ATGGCCTTCGGCACGCTCTTTACCTCCGCGGTACGCTCTTCATCCTCGACATGTCGTCACTGTCCTTGCTAGTAT
TTTCCGCGCATGACAAGGCTGACCATCTGGTCCTACAAATACAGGACAACCCGCGCTCAACCGCCATCAAGGCGA
TTGCCAAGGCCAACAACCTTGATCTCAAGATCGTCGAGGCTGACACCACCAAGCCGAGCATTGAGCACGTCAAGG
CCAATGGACTTGGCAAGATTCCCGCCTTCGTCGGCGAGGACGGCTATAATCTATCCGAGTGCATTGCCATCGCCA
TCTACGGTATGTCCCAGGCTCTCCTCTGCCTTTCGAGTTGTCTTGTCTGGTGGCCGGCGCCGGACTTTTTTTGCG
TGATGATCTAGCTTTCTTCATTTGACACAGTTATCCCTGTCAGAAAACATCATGTTGACAAAGCCTAACATCTGA
TTTTGTTCTGATTGCTTTCGCCATCTTTGGACTCGGCTTGGTGACAGACTCCTTACTGACTGCGAGCAGTCACCT
CCCAGAACGAGAAGACGACCCTTCTGGGCAAGACCAAGCAGGAGTCAGTAGAGTTTTGCCAGGTCGGTGGAAGAA
AACAGTCTAACTTTGATCAGTTATGCTTCGATCCTGAAGTGGATGTCGTTCTTCAACTCCGAGATCGTCCCTCCC
ATGGGCAACTGGTTCCTGCCCCTCCTCGGCAAGATCCCTTACAACAAGAAGTCTGTTGAAGACGCATCCAAGGCT
GTCCTCAAGGCTGTCGGCGTCGTCGAAAAGTACCTTGTTCGCCACACGTACCTGGTTGGTGAGCGCATCACCCTC
GCCGACCTGTTCTGCGCCAGCCTGCTGCACCGTGGCTTCCAGTACTTCTTCGACAAGCAGTGGCGCCAGGAGCAC
CCCAACACCACACGTTGGTACGATACCGTCGTCAACCAGCCCATCTACACGGCTGTGGCCAAGAAGCCCGATTAC
CTCGAGAAGCCCGCCTTGACCAACACTGCCCCCAAGAAGACCGAGCAGCCCAAGGCCGCCGCCCCCAAGGCCGCT
GCCGCTGCCGCCGCAGAGGAGGATGAGCCTGCTCCCGCCCCCAAGCCCAAGCACCCCTGTGAGGCTCTTCCCAAG
GCCTCCTTCCCTCTTGACGAGTGGAAGCGGCAATTCTCCAACAACGAGACCCCCGACGCTCTCAAGTGGTTCTGG
ACCAACGTTCCCCTGGAGGAAGAGTACTCCATCTGGCGTTGCGACTACAAGTACAACGATGAGCTCACCCTGACT
TTCATGTCGAACAACCTCATCGGCGGCTTCTTTGCCCGCTTAGAGGCCTCGCGCAAGTACATCTTCGGCAGCGCC
TCTGTCTATGGCGAGAGCAACAACTCGGTTATCCAGGGTGCCTTTGTCATCCGGGGCCAGAAGTTCGAGCCCGTC
TTTGACGTTGCTCCCGACTACGAGAGCTACCAGTTCACCAAGCTGGACCCTAAGAAGGCCGAGGACCGCGCGTTC
CTTGAGAACATGTGGTCGTGGGAAAAGCCTGTTGTCGCCGGCGGCAAGGAGCACGCCCACGCTTGCGGCAAGGTG
TTCAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail