Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6630
Gene name
LocationContig_346:2757..5442
Strand+
Gene length (bp)2685
Transcript length (bp)2568
Coding sequence length (bp)2568
Protein length (aa) 856

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17681 GCP_N_terminal Gamma tubulin complex component N-terminal 1.7E-38 245 550
PF04130 GCP_C_terminal Gamma tubulin complex component C-terminal 1.5E-31 555 831

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BKN5|GCP5_MOUSE Gamma-tubulin complex component 5 OS=Mus musculus GN=Tubgcp5 PE=2 SV=2 534 832 1.0E-21
sp|Q95K09|GCP5_MACFA Gamma-tubulin complex component 5 (Fragment) OS=Macaca fascicularis GN=TUBGCP5 PE=2 SV=2 534 832 3.0E-21
sp|Q96RT8|GCP5_HUMAN Gamma-tubulin complex component 5 OS=Homo sapiens GN=TUBGCP5 PE=1 SV=1 534 832 3.0E-21
sp|Q5R5J6|GCP2_PONAB Gamma-tubulin complex component 2 OS=Pongo abelii GN=TUBGCP2 PE=2 SV=1 412 765 5.0E-12
sp|Q9BSJ2|GCP2_HUMAN Gamma-tubulin complex component 2 OS=Homo sapiens GN=TUBGCP2 PE=1 SV=2 412 765 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BKN5|GCP5_MOUSE Gamma-tubulin complex component 5 OS=Mus musculus GN=Tubgcp5 PE=2 SV=2 534 832 1.0E-21
sp|Q95K09|GCP5_MACFA Gamma-tubulin complex component 5 (Fragment) OS=Macaca fascicularis GN=TUBGCP5 PE=2 SV=2 534 832 3.0E-21
sp|Q96RT8|GCP5_HUMAN Gamma-tubulin complex component 5 OS=Homo sapiens GN=TUBGCP5 PE=1 SV=1 534 832 3.0E-21
sp|Q5R5J6|GCP2_PONAB Gamma-tubulin complex component 2 OS=Pongo abelii GN=TUBGCP2 PE=2 SV=1 412 765 5.0E-12
sp|Q9BSJ2|GCP2_HUMAN Gamma-tubulin complex component 2 OS=Homo sapiens GN=TUBGCP2 PE=1 SV=2 412 765 1.0E-11
sp|Q9FG37|GACP3_ARATH Gamma-tubulin complex component 3 OS=Arabidopsis thaliana GN=GCP3 PE=1 SV=1 646 791 6.0E-08
sp|Q96CW5|GCP3_HUMAN Gamma-tubulin complex component 3 OS=Homo sapiens GN=TUBGCP3 PE=1 SV=2 392 788 6.0E-08
sp|P58854|GCP3_MOUSE Gamma-tubulin complex component 3 OS=Mus musculus GN=Tubgcp3 PE=1 SV=2 392 788 9.0E-08
sp|O73787|GCP3_XENLA Gamma-tubulin complex component 3 homolog OS=Xenopus laevis GN=tubgcp3 PE=1 SV=1 225 788 1.0E-07
sp|Q95ZG3|SPC97_DICDI Spindle pole body component 97 OS=Dictyostelium discoideum GN=spc97 PE=2 SV=2 638 834 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0043015 gamma-tubulin binding Yes
GO:0015631 tubulin binding No
GO:0005515 protein binding No
GO:0003674 molecular_function No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6630
MAFAARIGPLTEELVQSLTPSSAQAAGKLRSRCDACLRKLRSHPYLRTNPFEVDDRLDGLDERFRVNGRDGLADA
LRERRAALPRAAAAPASCLPDILFLLLELSDQPTFKTRLRDLEPPAPPAEAATARAHPPLRWEQVAAEDGWDGDG
DLWKSISYSSDDDDSDDSDRDRDSAVDSSDATSLSAQGDAAAVRLAEESIVHPEDDEALGAVLRAQQWRAQLPPP
HAARPDGSEPRVTVSEVQLVREALFMLHGLEGTLFDAAAPPFRLAHVADETLRALTGALAEPARHLRLLRSFVAR
PQTVAHLQTLQDCIARHLRDLDRGLADVQARLASPRGEVVVSLTLVMGELAPRLEPLLALSHIVARVQEAAESDT
FRYLELLFDETGVAQLAGKPGIYEFLARIFVDCFNVYLRPIRHWMHEGRLLPADELFFITEPSSGHVPLGDTWHS
RFCLRRAADGGLHAPSFLQPAAGKIYNAGKNIVVLKLLGSHDAAAVLSPQLHDDPPLDYYALCPPGFELAPFADL
FAAAFDRWVRSQYQRTSVTLKNALLRDWGLSASLDALRALYLMSDGHAAAAFCEALFAKLDATDAAWHGRHGLTA
AGREAFASRLDPNRLSVDFDAAASRLTASECRCSVKKALPAVRVGYRVPWPVQMIVSAESVSRYQAVFTLLLQIK
RASHALQKLKILDYYWTDHENWGERSLVYSARSKLLWFCSTIHAYLATLVLEPVESRMRRELEAAEDIDAMVAVH
SGAMKQMIDQACLGSSLQPIREAILDMLDLAIKLGHSQSHAPSEPAHGQSSSSLATLKEIATDFDRHLRFVAEGL
RSVARASSSSASAKWEILADMLQSDVGGGR*
Coding >Hirsu2|6630
ATGGCGTTTGCGGCGCGCATCGGACCTCTGACTGAGGAGCTGGTCCAAAGCCTGACCCCGTCGTCGGCCCAGGCG
GCCGGAAAGCTCCGGTCGAGATGCGACGCCTGCTTGCGGAAGCTCAGGTCTCACCCCTACCTGCGCACTAATCCG
TTCGAGGTCGACGACCGGCTCGACGGCCTGGACGAGCGCTTCCGCGTCAACGGCCGCGACGGCCTGGCCGACGCG
CTGCGCGAGAGACGCGCCGCCCTGCCCCGCGCCGCCGCCGCCCCTGCGTCCTGCCTCCCCGACATCCTCTTTCTG
CTCCTCGAGCTGTCCGACCAGCCGACCTTCAAGACACGGCTGCGCGACCTCGAGCCGCCCGCGCCGCCGGCCGAG
GCCGCCACCGCCCGCGCGCACCCGCCGCTCCGCTGGGAGCAGGTGGCTGCCGAGGACGGCTGGGACGGCGACGGG
GACCTGTGGAAGTCCATCAGCTACAGCAGCGACGACGACGACTCCGACGACAGCGACCGCGACCGCGACTCGGCC
GTCGACTCGTCCGACGCCACCTCGCTCTCCGCCCAGGGGGATGCCGCCGCCGTCAGGCTGGCCGAGGAGTCCATC
GTTCACCCCGAAGACGACGAGGCGCTGGGAGCGGTCCTGAGGGCACAGCAGTGGCGCGCGCAGCTCCCGCCGCCG
CACGCCGCGCGGCCCGATGGCTCCGAGCCCAGAGTCACCGTCTCCGAGGTGCAGCTCGTCCGCGAGGCCCTCTTC
ATGCTGCACGGCCTCGAGGGCACCCTCTTCGACGCCGCCGCGCCGCCCTTCCGGCTGGCGCACGTGGCGGACGAG
ACGCTCCGGGCGCTGACGGGCGCCTTGGCGGAGCCCGCCCGCCATCTGCGCCTGCTGCGCAGCTTCGTGGCCCGC
CCGCAGACTGTGGCTCACCTCCAGACGCTGCAGGACTGCATCGCCCGCCATCTGCGCGACCTGGACCGCGGGCTC
GCCGACGTCCAGGCTCGCCTCGCCTCGCCGCGGGGAGAGGTCGTCGTCAGCCTGACGCTCGTGATGGGAGAGCTC
GCGCCCCGGCTCGAGCCCCTCCTCGCCCTGTCGCACATCGTGGCCAGGGTCCAGGAGGCGGCCGAGTCGGACACC
TTCCGCTACCTGGAGCTCCTCTTCGACGAGACGGGCGTGGCACAGCTGGCGGGCAAGCCCGGCATCTACGAGTTC
CTCGCCCGCATCTTCGTCGACTGTTTCAACGTCTACCTACGCCCCATCCGTCACTGGATGCACGAGGGCAGGCTG
CTTCCAGCCGACGAGCTCTTCTTCATCACTGAACCATCCTCCGGCCACGTCCCGCTGGGCGACACCTGGCACAGC
CGCTTCTGCCTGCGTCGGGCGGCGGACGGGGGCCTCCATGCGCCGAGCTTCCTGCAGCCGGCCGCGGGCAAGATC
TACAACGCCGGTAAGAACATCGTGGTGCTCAAGCTGTTGGGCAGCCATGATGCGGCGGCCGTCTTGTCCCCGCAG
CTCCACGACGACCCGCCTCTCGACTACTATGCGCTTTGCCCCCCCGGCTTCGAGCTTGCCCCGTTCGCAGACCTG
TTCGCCGCCGCCTTTGATCGCTGGGTCCGGAGCCAGTATCAGAGGACCTCGGTGACGCTGAAGAACGCGCTCCTG
CGAGACTGGGGCCTGTCTGCCTCGCTCGACGCTCTGCGCGCCCTGTACCTCATGTCGGACGGACACGCGGCCGCT
GCCTTCTGCGAGGCCCTCTTCGCCAAGCTGGACGCAACGGATGCCGCCTGGCACGGTCGACATGGCCTCACCGCG
GCGGGCCGCGAGGCTTTCGCGTCGCGCCTCGACCCCAACCGACTGTCCGTCGATTTCGACGCTGCGGCGTCTCGC
CTGACCGCATCCGAGTGTCGGTGTTCCGTCAAAAAGGCCCTTCCGGCTGTCCGAGTCGGCTACAGGGTGCCGTGG
CCGGTGCAGATGATTGTGTCGGCCGAGAGCGTGTCGCGCTATCAGGCCGTGTTCACGTTGCTCTTGCAAATCAAG
AGGGCATCGCACGCCCTCCAAAAGCTCAAAATCCTCGATTACTACTGGACAGACCATGAAAACTGGGGCGAGCGT
AGCCTGGTCTATTCCGCGAGGAGTAAACTCCTTTGGTTCTGCTCCACCATCCATGCATATCTCGCGACCCTGGTC
CTGGAACCGGTCGAGTCCCGCATGAGGCGCGAATTGGAAGCTGCCGAGGATATCGACGCCATGGTCGCCGTCCAC
TCCGGGGCCATGAAGCAGATGATCGATCAGGCGTGCCTCGGAAGCAGCCTCCAGCCCATCCGAGAAGCGATCCTC
GACATGTTGGATCTGGCAATCAAGCTCGGACACAGTCAGAGCCACGCGCCTAGCGAACCCGCACACGGGCAGTCG
TCGTCGTCCTTGGCGACTCTGAAGGAGATAGCTACCGATTTTGATCGCCATCTGCGCTTCGTCGCCGAGGGATTG
CGGAGCGTCGCGAGGGCGAGCAGCAGTTCTGCATCAGCCAAGTGGGAGATTCTGGCCGACATGCTTCAGTCCGAC
GTCGGGGGCGGGCGATGA
Transcript >Hirsu2|6630
ATGGCGTTTGCGGCGCGCATCGGACCTCTGACTGAGGAGCTGGTCCAAAGCCTGACCCCGTCGTCGGCCCAGGCG
GCCGGAAAGCTCCGGTCGAGATGCGACGCCTGCTTGCGGAAGCTCAGGTCTCACCCCTACCTGCGCACTAATCCG
TTCGAGGTCGACGACCGGCTCGACGGCCTGGACGAGCGCTTCCGCGTCAACGGCCGCGACGGCCTGGCCGACGCG
CTGCGCGAGAGACGCGCCGCCCTGCCCCGCGCCGCCGCCGCCCCTGCGTCCTGCCTCCCCGACATCCTCTTTCTG
CTCCTCGAGCTGTCCGACCAGCCGACCTTCAAGACACGGCTGCGCGACCTCGAGCCGCCCGCGCCGCCGGCCGAG
GCCGCCACCGCCCGCGCGCACCCGCCGCTCCGCTGGGAGCAGGTGGCTGCCGAGGACGGCTGGGACGGCGACGGG
GACCTGTGGAAGTCCATCAGCTACAGCAGCGACGACGACGACTCCGACGACAGCGACCGCGACCGCGACTCGGCC
GTCGACTCGTCCGACGCCACCTCGCTCTCCGCCCAGGGGGATGCCGCCGCCGTCAGGCTGGCCGAGGAGTCCATC
GTTCACCCCGAAGACGACGAGGCGCTGGGAGCGGTCCTGAGGGCACAGCAGTGGCGCGCGCAGCTCCCGCCGCCG
CACGCCGCGCGGCCCGATGGCTCCGAGCCCAGAGTCACCGTCTCCGAGGTGCAGCTCGTCCGCGAGGCCCTCTTC
ATGCTGCACGGCCTCGAGGGCACCCTCTTCGACGCCGCCGCGCCGCCCTTCCGGCTGGCGCACGTGGCGGACGAG
ACGCTCCGGGCGCTGACGGGCGCCTTGGCGGAGCCCGCCCGCCATCTGCGCCTGCTGCGCAGCTTCGTGGCCCGC
CCGCAGACTGTGGCTCACCTCCAGACGCTGCAGGACTGCATCGCCCGCCATCTGCGCGACCTGGACCGCGGGCTC
GCCGACGTCCAGGCTCGCCTCGCCTCGCCGCGGGGAGAGGTCGTCGTCAGCCTGACGCTCGTGATGGGAGAGCTC
GCGCCCCGGCTCGAGCCCCTCCTCGCCCTGTCGCACATCGTGGCCAGGGTCCAGGAGGCGGCCGAGTCGGACACC
TTCCGCTACCTGGAGCTCCTCTTCGACGAGACGGGCGTGGCACAGCTGGCGGGCAAGCCCGGCATCTACGAGTTC
CTCGCCCGCATCTTCGTCGACTGTTTCAACGTCTACCTACGCCCCATCCGTCACTGGATGCACGAGGGCAGGCTG
CTTCCAGCCGACGAGCTCTTCTTCATCACTGAACCATCCTCCGGCCACGTCCCGCTGGGCGACACCTGGCACAGC
CGCTTCTGCCTGCGTCGGGCGGCGGACGGGGGCCTCCATGCGCCGAGCTTCCTGCAGCCGGCCGCGGGCAAGATC
TACAACGCCGGTAAGAACATCGTGGTGCTCAAGCTGTTGGGCAGCCATGATGCGGCGGCCGTCTTGTCCCCGCAG
CTCCACGACGACCCGCCTCTCGACTACTATGCGCTTTGCCCCCCCGGCTTCGAGCTTGCCCCGTTCGCAGACCTG
TTCGCCGCCGCCTTTGATCGCTGGGTCCGGAGCCAGTATCAGAGGACCTCGGTGACGCTGAAGAACGCGCTCCTG
CGAGACTGGGGCCTGTCTGCCTCGCTCGACGCTCTGCGCGCCCTGTACCTCATGTCGGACGGACACGCGGCCGCT
GCCTTCTGCGAGGCCCTCTTCGCCAAGCTGGACGCAACGGATGCCGCCTGGCACGGTCGACATGGCCTCACCGCG
GCGGGCCGCGAGGCTTTCGCGTCGCGCCTCGACCCCAACCGACTGTCCGTCGATTTCGACGCTGCGGCGTCTCGC
CTGACCGCATCCGAGTGTCGGTGTTCCGTCAAAAAGGCCCTTCCGGCTGTCCGAGTCGGCTACAGGGTGCCGTGG
CCGGTGCAGATGATTGTGTCGGCCGAGAGCGTGTCGCGCTATCAGGCCGTGTTCACGTTGCTCTTGCAAATCAAG
AGGGCATCGCACGCCCTCCAAAAGCTCAAAATCCTCGATTACTACTGGACAGACCATGAAAACTGGGGCGAGCGT
AGCCTGGTCTATTCCGCGAGGAGTAAACTCCTTTGGTTCTGCTCCACCATCCATGCATATCTCGCGACCCTGGTC
CTGGAACCGGTCGAGTCCCGCATGAGGCGCGAATTGGAAGCTGCCGAGGATATCGACGCCATGGTCGCCGTCCAC
TCCGGGGCCATGAAGCAGATGATCGATCAGGCGTGCCTCGGAAGCAGCCTCCAGCCCATCCGAGAAGCGATCCTC
GACATGTTGGATCTGGCAATCAAGCTCGGACACAGTCAGAGCCACGCGCCTAGCGAACCCGCACACGGGCAGTCG
TCGTCGTCCTTGGCGACTCTGAAGGAGATAGCTACCGATTTTGATCGCCATCTGCGCTTCGTCGCCGAGGGATTG
CGGAGCGTCGCGAGGGCGAGCAGCAGTTCTGCATCAGCCAAGTGGGAGATTCTGGCCGACATGCTTCAGTCCGAC
GTCGGGGGCGGGCGATGA
Gene >Hirsu2|6630
ATGGCGTTTGCGGCGCGCATCGGACCTCTGACTGAGGAGCTGGTCCAAAGCCTGACCCCGTCGTCGGCCCAGGTA
AGGATTGGGAGGGGGAGAGGCTCCGCGTCTCCGCCGTCGTGTCAGCGCGACCCCATGTCGAGAGAGGGGGGGAGA
AGGAGAAAAGATGACAACAACTGACCGCAGCTCTCGCAGGCGGCCGGAAAGCTCCGGTCGAGATGCGACGCCTGC
TTGCGGAAGCTCAGGTCTCACCCCTACCTGCGCACTAATCCGTTCGAGGTCGACGACCGGCTCGACGGCCTGGAC
GAGCGCTTCCGCGTCAACGGCCGCGACGGCCTGGCCGACGCGCTGCGCGAGAGACGCGCCGCCCTGCCCCGCGCC
GCCGCCGCCCCTGCGTCCTGCCTCCCCGACATCCTCTTTCTGCTCCTCGAGCTGTCCGACCAGCCGACCTTCAAG
ACACGGCTGCGCGACCTCGAGCCGCCCGCGCCGCCGGCCGAGGCCGCCACCGCCCGCGCGCACCCGCCGCTCCGC
TGGGAGCAGGTGGCTGCCGAGGACGGCTGGGACGGCGACGGGGACCTGTGGAAGTCCATCAGCTACAGCAGCGAC
GACGACGACTCCGACGACAGCGACCGCGACCGCGACTCGGCCGTCGACTCGTCCGACGCCACCTCGCTCTCCGCC
CAGGGGGATGCCGCCGCCGTCAGGCTGGCCGAGGAGTCCATCGTTCACCCCGAAGACGACGAGGCGCTGGGAGCG
GTCCTGAGGGCACAGCAGTGGCGCGCGCAGCTCCCGCCGCCGCACGCCGCGCGGCCCGATGGCTCCGAGCCCAGA
GTCACCGTCTCCGAGGTGCAGCTCGTCCGCGAGGCCCTCTTCATGCTGCACGGCCTCGAGGGCACCCTCTTCGAC
GCCGCCGCGCCGCCCTTCCGGCTGGCGCACGTGGCGGACGAGACGCTCCGGGCGCTGACGGGCGCCTTGGCGGAG
CCCGCCCGCCATCTGCGCCTGCTGCGCAGCTTCGTGGCCCGCCCGCAGACTGTGGCTCACCTCCAGACGCTGCAG
GACTGCATCGCCCGCCATCTGCGCGACCTGGACCGCGGGCTCGCCGACGTCCAGGCTCGCCTCGCCTCGCCGCGG
GGAGAGGTCGTCGTCAGCCTGACGCTCGTGATGGGAGAGCTCGCGCCCCGGCTCGAGCCCCTCCTCGCCCTGTCG
CACATCGTGGCCAGGGTCCAGGAGGCGGCCGAGTCGGACACCTTCCGCTACCTGGAGCTCCTCTTCGACGAGACG
GGCGTGGCACAGCTGGCGGGCAAGCCCGGCATCTACGAGTTCCTCGCCCGCATCTTCGTCGACTGTTTCAACGTC
TACCTACGCCCCATCCGTCACTGGATGCACGAGGGCAGGCTGCTTCCAGCCGACGAGCTCTTCTTCATCACTGAA
CCATCCTCCGGCCACGTCCCGCTGGGCGACACCTGGCACAGCCGCTTCTGCCTGCGTCGGGCGGCGGACGGGGGC
CTCCATGCGCCGAGCTTCCTGCAGCCGGCCGCGGGCAAGATCTACAACGCCGGTAAGAACATCGTGGTGCTCAAG
CTGTTGGGCAGCCATGATGCGGCGGCCGTCTTGTCCCCGCAGCTCCACGACGACCCGCCTCTCGACTACTATGCG
CTTTGCCCCCCCGGCTTCGAGCTTGCCCCGTTCGCAGACCTGTTCGCCGCCGCCTTTGATCGCTGGGTCCGGAGC
CAGTATCAGAGGACCTCGGTGACGCTGAAGAACGCGCTCCTGCGAGACTGGGGCCTGTCTGCCTCGCTCGACGCT
CTGCGCGCCCTGTACCTCATGTCGGACGGACACGCGGCCGCTGCCTTCTGCGAGGCCCTCTTCGCCAAGCTGGAC
GCAACGGATGCCGCCTGGCACGGTCGACATGGCCTCACCGCGGCGGGCCGCGAGGCTTTCGCGTCGCGCCTCGAC
CCCAACCGACTGTCCGTCGATTTCGACGCTGCGGCGTCTCGCCTGACCGCATCCGAGTGTCGGTGTTCCGTCAAA
AAGGCCCTTCCGGCTGTCCGAGTCGGCTACAGGGTGCCGTGGCCGGTGCAGATGATTGTGTCGGCCGAGAGCGTG
TCGCGCTATCAGGCCGTGTTCACGTTGCTCTTGCAAATCAAGAGGGCATCGCACGCCCTCCAAAAGCTCAAAATC
CTCGATTACTACTGGACAGACCATGAAAACTGGGGCGAGCGTAGCCTGGTCTATTCCGCGAGGAGTAAACTCCTT
TGGTTCTGCTCCACCATCCATGCATATCTCGCGACCCTGGTCCTGGAACCGGTCGAGTCCCGCATGAGGCGCGAA
TTGGAAGCTGCCGAGGATATCGACGCCATGGTCGCCGTCCACTCCGGGGCCATGAAGCAGATGATCGATCAGGCG
TGCCTCGGAAGCAGCCTCCAGCCCATCCGAGAAGCGATCCTCGACATGTTGGATCTGGCAATCAAGCTCGGACAC
AGTCAGAGCCACGCGCCTAGCGAACCCGCACACGGGCAGTCGTCGTCGTCCTTGGCGACTCTGAAGGAGATAGCT
ACCGATTTTGATCGCCATCTGCGCTTCGTCGCCGAGGGATTGCGGAGCGTCGCGAGGGCGAGCAGCAGTTCTGCA
TCAGCCAAGTGGGAGATTCTGGCCGACATGCTTCAGTCCGACGTCGGGGGCGGGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail