Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6622
Gene name
LocationContig_345:11792..13225
Strand+
Gene length (bp)1433
Transcript length (bp)1335
Coding sequence length (bp)1335
Protein length (aa) 445

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6013 0.5819 0.1037 0.0971 0.3899 0.0648 0.0456 0.1314 0.0933 0.0035

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6585
Change Orthofinder run
Species Protein ID
Ophiocordyceps kimflemingae Ophio5|1710
Ophiocordyceps subramaniannii Hirsu2|31
Ophiocordyceps subramaniannii Hirsu2|6622 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6622
MTPVSDAQSRFVYDVGVIGNGPRGAALAINAVVVALCEAERFEAIQTHGTPFRIRFHVYEQKSWHDRAVGNAFSP
RCHAVINTPVVGPSDICIPNLDKVDKRHAKIIRHATDLRGCLATHVESNWADILTEYERVNAAAAACLRYATRRD
GTVDASLPYVTRGTMGKMLQQQLDAVMKEGAKAVPFLAFHFQHETEVVACNISSDRQRPWIITRDIKSNRVTKHI
FDHLILAGGTASEVPVKDELLGRTYLGEANFDDIQRFFGRLGLLLPDGRLNPDTKVLVLGMGLSAMDKSTIGSAS
FVRRSGSDPCGFEFDDAYVGCFTNLSRNPGRYVAPRQTFSHHWLGPTHQPLSQLIIRAAFMDDSPKTLSNLLYIL
YAAAARALGTTPDRNPLLLRTPLEWQLETYKENLHYLGGTTPEARSHTWSGYLRAGMLAIMHGGGFEGS*
Coding >Hirsu2|6622
ATGACTCCGGTGTCGGATGCACAGTCTCGTTTTGTTTATGACGTGGGAGTCATCGGAAACGGTCCACGGGGGGCT
GCCCTAGCCATAAACGCCGTCGTGGTCGCGCTTTGCGAGGCAGAGAGATTCGAAGCCATCCAAACCCACGGCACC
CCGTTCCGAATCCGCTTCCACGTGTATGAGCAAAAGTCCTGGCACGACCGAGCGGTGGGCAACGCCTTCTCTCCG
AGGTGTCATGCCGTCATCAACACGCCCGTCGTCGGCCCTTCCGACATCTGCATCCCGAATCTCGACAAGGTGGAC
AAGAGACACGCCAAAATCATCCGTCACGCAACCGATCTGCGCGGCTGCCTGGCAACGCATGTCGAGTCGAACTGG
GCCGACATCTTGACCGAGTACGAGCGCGTGAATGCCGCGGCGGCGGCCTGCCTGCGTTACGCAACGCGCCGCGAC
GGGACCGTCGACGCCTCGCTGCCATATGTGACCCGTGGTACGATGGGAAAGATGTTGCAGCAGCAACTGGACGCC
GTCATGAAGGAAGGGGCCAAGGCGGTGCCTTTTCTCGCGTTTCACTTCCAGCACGAGACCGAGGTCGTTGCCTGC
AACATTTCGAGCGACCGGCAGAGACCATGGATCATAACGAGAGATATCAAAAGTAACCGGGTGACAAAGCACATA
TTCGACCACTTGATCCTAGCTGGAGGCACTGCATCCGAGGTCCCCGTCAAGGACGAGCTTCTCGGGCGAACCTAT
CTAGGTGAGGCAAATTTCGACGACATCCAGCGATTCTTCGGTAGGCTCGGACTCCTCCTCCCCGACGGACGCCTC
AATCCCGATACTAAAGTCCTCGTCCTCGGGATGGGTCTCTCTGCCATGGACAAGTCCACGATTGGGTCTGCTAGC
TTCGTGCGTCGCTCCGGATCTGACCCTTGCGGGTTTGAATTCGACGACGCGTACGTCGGGTGCTTCACGAACCTG
AGCCGCAACCCCGGTCGCTACGTCGCTCCTCGACAGACATTCAGCCACCATTGGCTTGGCCCGACCCATCAGCCG
CTCAGCCAGCTTATCATCAGGGCCGCTTTCATGGACGACTCTCCCAAGACTCTATCCAACCTCCTCTACATCCTG
TACGCCGCGGCCGCCCGTGCCTTGGGTACAACGCCGGATCGAAACCCGCTACTTCTTCGGACTCCGTTGGAGTGG
CAGCTGGAGACATATAAGGAGAACCTGCATTACCTCGGCGGCACCACCCCGGAAGCCAGGAGCCACACGTGGTCC
GGCTATCTGAGGGCTGGAATGCTGGCGATAATGCATGGCGGGGGGTTCGAGGGGTCCTGA
Transcript >Hirsu2|6622
ATGACTCCGGTGTCGGATGCACAGTCTCGTTTTGTTTATGACGTGGGAGTCATCGGAAACGGTCCACGGGGGGCT
GCCCTAGCCATAAACGCCGTCGTGGTCGCGCTTTGCGAGGCAGAGAGATTCGAAGCCATCCAAACCCACGGCACC
CCGTTCCGAATCCGCTTCCACGTGTATGAGCAAAAGTCCTGGCACGACCGAGCGGTGGGCAACGCCTTCTCTCCG
AGGTGTCATGCCGTCATCAACACGCCCGTCGTCGGCCCTTCCGACATCTGCATCCCGAATCTCGACAAGGTGGAC
AAGAGACACGCCAAAATCATCCGTCACGCAACCGATCTGCGCGGCTGCCTGGCAACGCATGTCGAGTCGAACTGG
GCCGACATCTTGACCGAGTACGAGCGCGTGAATGCCGCGGCGGCGGCCTGCCTGCGTTACGCAACGCGCCGCGAC
GGGACCGTCGACGCCTCGCTGCCATATGTGACCCGTGGTACGATGGGAAAGATGTTGCAGCAGCAACTGGACGCC
GTCATGAAGGAAGGGGCCAAGGCGGTGCCTTTTCTCGCGTTTCACTTCCAGCACGAGACCGAGGTCGTTGCCTGC
AACATTTCGAGCGACCGGCAGAGACCATGGATCATAACGAGAGATATCAAAAGTAACCGGGTGACAAAGCACATA
TTCGACCACTTGATCCTAGCTGGAGGCACTGCATCCGAGGTCCCCGTCAAGGACGAGCTTCTCGGGCGAACCTAT
CTAGGTGAGGCAAATTTCGACGACATCCAGCGATTCTTCGGTAGGCTCGGACTCCTCCTCCCCGACGGACGCCTC
AATCCCGATACTAAAGTCCTCGTCCTCGGGATGGGTCTCTCTGCCATGGACAAGTCCACGATTGGGTCTGCTAGC
TTCGTGCGTCGCTCCGGATCTGACCCTTGCGGGTTTGAATTCGACGACGCGTACGTCGGGTGCTTCACGAACCTG
AGCCGCAACCCCGGTCGCTACGTCGCTCCTCGACAGACATTCAGCCACCATTGGCTTGGCCCGACCCATCAGCCG
CTCAGCCAGCTTATCATCAGGGCCGCTTTCATGGACGACTCTCCCAAGACTCTATCCAACCTCCTCTACATCCTG
TACGCCGCGGCCGCCCGTGCCTTGGGTACAACGCCGGATCGAAACCCGCTACTTCTTCGGACTCCGTTGGAGTGG
CAGCTGGAGACATATAAGGAGAACCTGCATTACCTCGGCGGCACCACCCCGGAAGCCAGGAGCCACACGTGGTCC
GGCTATCTGAGGGCTGGAATGCTGGCGATAATGCATGGCGGGGGGTTCGAGGGGTCCTGA
Gene >Hirsu2|6622
ATGACTCCGGTGTCGGATGCACAGTCTCGTTTTGTTTATGACGTGGGAGTCATCGGAAACGGTCCACGGGGGGCT
GCCCTAGCCATAAACGCCGTCGTGGTCGCGCTTTGCGAGGCAGAGAGATTCGAAGCCATCCAAACCCACGGCACC
CCGTTCCGAATCCGCTTCCACGTGTATGAGCAAAAGTCCTGGCACGACCGAGCGGTGGGCAACGCCTTCTCTCCG
AGGTGTCATGCCGTCATCAACACGCCCGTCGTCGGCCCTTCCGACATCTGCATCCCGAATCTCGACAAGGTGGAC
AAGAGACACGCCAAAATCATCCGTCACGCAACCGATCTGCGCGGCTGCCTGGCAACGCATGTCGAGTCGAACTGG
GCCGACATCTTGACCGAGTACGAGCGCGTGAATGCCGCGGCGGCGGCCTGCCTGCGTTACGCAACGCGCCGCGAC
GGGACCGTCGACGCCTCGCTGCCATATGTGACCCGTGGTACGATGGGAAAGATGTTGCAGCAGCAACTGGACGCC
GTCATGAAGGAAGGGGCCAAGGCGGTGCCTTTTCTCGCGTTTCACTTCCAGCACGAGACCGAGGTCGTTGCCTGC
AACATTTCGAGCGACCGGCAGAGACCATGGATCATAACGAGAGATATCAAAAGTAACCGGGTGACAAAGCACATA
TTCGACCACTTGATCCTAGCTGGAGGCACTGCATCCGAGGTCCCCGTCAAGGACGAGCTTCTCGGGCGAACCTAT
CTAGGTGAGGCAAATTTCGACGACATCCAGCGATTCTTCGGTAGGCTCGGACTCCTCCTCCCCGACGGACGCCTC
AATCCCGATACTAAAGTCCTCGTCCTCGGGATGGGTCTCTCTGCCATGGACAAGTCCACGATTGGGTCTGCTAGC
TTCGTGCGTCGCTCCGGATCTGACCCTTGCGGGTTTGAATTCGACGACGCGTACGTCGGGTGCTTCACGAACCTG
AGCCGCAACCCCGGTCGCTACGTCGCTCCTCGACAGACATTCAGCCACCATTGGCTTGGCCCGACCCATCAGCCG
CTCAGCCAGCTTATCATCAGGGCCGCTTTCATGGACGACTCTCCCAAGACTCTATCCAACCTCCTCTACATCCTG
TACGCCGCGGCCGCCCGTGCCTTGGGTACAACGCCGGATCGAAACCCGCTACTTCTTCGGACTCCGTTGGAGTGG
CAGCTGGAGACATATAAGGAGAACCTGCATTACCTCGGCGGCACCACCCCGGAAGCCAGGAGCCACACGTGGTCC
GGCTATCTGAGGGCTGGAATGCTGGCGATAATGCATGGCGGGGGGTTCGAGGGGTGTGAGCCGGTCAAAGATGAC
GATGGCCTTCTTGAACGGTTAACCAGAGGGCGGCATGGGTTTGAAGTATCCCGTGCGATGGCGTCACACTATACC
AAGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail