Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6616
Gene name
LocationContig_344:19715..22265
Strand+
Gene length (bp)2550
Transcript length (bp)1914
Coding sequence length (bp)1914
Protein length (aa) 638

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.5E-90 128 591

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 197 592 2.0E-50
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 125 592 2.0E-48
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 125 592 2.0E-48
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 197 591 3.0E-46
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 125 591 1.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 197 592 2.0E-50
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 125 592 2.0E-48
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 125 592 2.0E-48
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 197 591 3.0E-46
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 125 591 1.0E-45
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 187 588 2.0E-43
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 187 588 2.0E-43
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 189 588 5.0E-42
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 189 588 5.0E-42
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 187 588 5.0E-42
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 193 591 5.0E-41
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 105 607 1.0E-40
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 193 588 2.0E-40
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 193 591 2.0E-40
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 188 597 4.0E-40
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 105 607 9.0E-40
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 187 607 2.0E-39
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 105 607 3.0E-39
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 193 590 4.0E-39
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 68 629 4.0E-39
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 187 588 6.0E-39
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 189 590 1.0E-38
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 94 591 2.0E-38
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 97 591 3.0E-38
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 187 599 3.0E-37
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 187 603 3.0E-37
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 120 591 3.0E-37
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 106 634 3.0E-37
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 183 587 8.0E-37
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 189 590 9.0E-37
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 189 587 1.0E-36
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 189 629 1.0E-36
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 188 590 2.0E-36
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 196 590 4.0E-36
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 102 587 4.0E-36
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 169 629 5.0E-36
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 120 587 6.0E-36
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 189 615 3.0E-35
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 192 587 3.0E-35
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 198 591 6.0E-35
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 120 587 7.0E-35
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 95 591 1.0E-34
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 187 591 1.0E-34
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 85 632 1.0E-34
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 85 632 2.0E-34
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 196 591 2.0E-34
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 195 600 2.0E-34
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 183 587 2.0E-34
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 96 629 3.0E-34
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 101 600 3.0E-34
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 195 608 4.0E-34
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 188 601 4.0E-34
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 168 592 6.0E-34
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 123 591 6.0E-34
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 106 634 8.0E-34
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 195 600 1.0E-33
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 195 600 1.0E-33
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 195 591 1.0E-33
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 183 601 4.0E-33
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 124 604 4.0E-33
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 189 598 7.0E-33
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 125 588 1.0E-32
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 183 601 2.0E-32
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 187 601 2.0E-32
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 189 591 2.0E-32
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 198 591 2.0E-32
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 74 629 3.0E-32
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 222 591 3.0E-32
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 193 588 4.0E-32
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 189 601 4.0E-32
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 189 591 4.0E-32
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 201 591 4.0E-32
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 201 592 5.0E-32
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 222 591 6.0E-32
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 111 590 6.0E-32
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 222 591 7.0E-32
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 169 591 8.0E-32
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 189 601 9.0E-32
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 192 589 1.0E-31
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 145 597 1.0E-31
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 195 600 1.0E-31
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 201 591 1.0E-31
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 198 591 2.0E-31
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 192 588 2.0E-31
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 196 600 2.0E-31
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 128 591 2.0E-31
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 106 634 2.0E-31
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 192 591 2.0E-31
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 233 597 2.0E-31
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 233 597 2.0E-31
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 192 600 2.0E-31
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 94 629 4.0E-31
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 201 591 4.0E-31
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 196 600 6.0E-31
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 69 629 6.0E-31
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 69 629 6.0E-31
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 188 587 7.0E-31
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 124 604 7.0E-31
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 96 588 7.0E-31
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 187 592 8.0E-31
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 187 587 9.0E-31
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 180 591 9.0E-31
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 69 629 1.0E-30
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 201 591 1.0E-30
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 187 588 1.0E-30
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 124 591 1.0E-30
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 198 596 2.0E-30
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 189 591 4.0E-30
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 198 596 4.0E-30
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 201 587 6.0E-30
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 233 590 7.0E-30
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 193 588 7.0E-30
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 193 588 8.0E-30
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 168 598 8.0E-30
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 196 588 8.0E-30
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 193 588 9.0E-30
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 144 588 1.0E-29
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 201 591 2.0E-29
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 192 591 2.0E-29
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 201 591 2.0E-29
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 201 587 2.0E-29
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 189 601 3.0E-29
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 193 588 6.0E-29
sp|P58351|GTR2_BOVIN Solute carrier family 2, facilitated glucose transporter member 2 OS=Bos taurus GN=SLC2A2 PE=2 SV=2 187 534 6.0E-29
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 182 592 6.0E-29
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 195 600 8.0E-29
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 197 478 1.0E-28
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 201 587 1.0E-28
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 124 591 2.0E-28
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 99 587 2.0E-28
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 165 600 2.0E-28
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 197 478 2.0E-28
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 201 587 3.0E-28
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 187 591 3.0E-28
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 201 591 3.0E-28
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 195 600 3.0E-28
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 195 600 3.0E-28
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 132 591 3.0E-28
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 201 587 6.0E-28
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 198 588 6.0E-28
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 207 587 7.0E-28
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 124 590 8.0E-28
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 195 600 1.0E-27
sp|Q39524|HUP2_PARKE H(+)/hexose cotransporter 2 OS=Parachlorella kessleri GN=HUP2 PE=2 SV=1 156 592 1.0E-27
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 201 587 1.0E-27
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 196 478 2.0E-27
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 189 590 2.0E-27
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 86 588 3.0E-27
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 195 600 4.0E-27
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 195 600 4.0E-27
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 201 591 5.0E-27
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 165 588 5.0E-27
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 195 600 9.0E-27
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 102 473 1.0E-26
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 122 590 3.0E-26
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 124 591 3.0E-26
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 196 588 5.0E-26
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 195 600 6.0E-26
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 165 600 7.0E-26
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 195 600 1.0E-25
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 165 588 1.0E-25
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 149 600 1.0E-25
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 198 600 2.0E-25
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 165 588 2.0E-25
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 193 587 2.0E-25
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 196 590 3.0E-25
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 195 600 3.0E-25
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 196 601 4.0E-25
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 195 600 5.0E-25
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 193 588 7.0E-25
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 201 592 1.0E-24
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 196 601 2.0E-24
sp|Q863Y9|GTR5_HORSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Equus caballus GN=SLC2A5 PE=2 SV=1 183 591 4.0E-24
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 195 600 5.0E-24
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 192 588 2.0E-23
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 187 588 2.0E-23
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 187 588 5.0E-23
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 183 591 1.0E-22
sp|Q9JJZ1|GTR8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus GN=Slc2a8 PE=1 SV=1 241 591 2.0E-22
sp|Q5RET7|GTR5_PONAB Solute carrier family 2, facilitated glucose transporter member 5 OS=Pongo abelii GN=SLC2A5 PE=2 SV=1 183 601 3.0E-22
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 193 588 6.0E-22
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 183 591 1.0E-21
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 121 592 1.0E-21
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 187 602 2.0E-21
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 104 475 2.0E-21
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 197 461 2.0E-21
sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 SV=1 187 588 6.0E-21
sp|Q9JIF3|GTR8_MOUSE Solute carrier family 2, facilitated glucose transporter member 8 OS=Mus musculus GN=Slc2a8 PE=1 SV=2 241 591 9.0E-21
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 183 591 2.0E-20
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 183 591 3.0E-20
sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2 196 597 6.0E-20
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 123 339 2.0E-19
sp|P22732|GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens GN=SLC2A5 PE=1 SV=1 183 601 3.0E-19
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 188 545 3.0E-19
sp|P38142|YB91_YEAST Probable metabolite transport protein YBR241C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR241C PE=1 SV=1 201 583 8.0E-19
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 107 600 2.0E-17
sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 184 588 5.0E-17
sp|P58354|GTR8_BOVIN Solute carrier family 2, facilitated glucose transporter member 8 OS=Bos taurus GN=SLC2A8 PE=2 SV=2 191 591 1.0E-16
sp|Q32NG5|GTR12_XENLA Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1 189 496 2.0E-16
sp|Q9NY64|GTR8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens GN=SLC2A8 PE=1 SV=3 191 591 2.0E-16
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 384 597 2.0E-15
sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS73 PE=1 SV=1 188 582 6.0E-15
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 171 603 1.0E-14
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 171 603 1.0E-14
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 171 603 1.0E-14
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 171 603 2.0E-14
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 171 603 2.0E-14
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 384 600 2.0E-14
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 384 598 3.0E-14
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 187 506 6.0E-14
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 128 337 7.0E-14
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 133 420 8.0E-14
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 171 603 2.0E-13
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 384 591 3.0E-13
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 198 457 4.0E-13
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 171 603 7.0E-13
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 187 487 4.0E-12
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 187 357 5.0E-12
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 187 487 5.0E-12
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 187 487 6.0E-12
sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 188 458 1.0E-11
sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 PE=1 SV=1 192 600 2.0E-11
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 190 586 3.0E-11
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 493 593 2.0E-10
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 497 591 2.0E-10
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 497 591 2.0E-10
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 497 591 3.0E-10
sp|P46408|GTR5_RABIT Solute carrier family 2, facilitated glucose transporter member 5 OS=Oryctolagus cuniculus GN=SLC2A5 PE=2 SV=1 188 587 5.0E-10
sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 183 543 8.0E-10
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 493 588 2.0E-09
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 11 344 2.0E-09
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 11 344 6.0E-09
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 187 588 1.0E-08
sp|P53403|GTR3_DROME Glucose transporter type 3 OS=Drosophila melanogaster GN=Glut3 PE=2 SV=1 199 581 9.0E-08
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 10 344 1.0E-07
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 94 390 4.0E-07
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 94 390 4.0E-07
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 154 361 6.0E-07
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 154 361 6.0E-07
sp|Q5R540|S22A7_PONAB Solute carrier family 22 member 7 OS=Pongo abelii GN=SLC22A7 PE=2 SV=1 134 527 6.0E-07
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 154 361 6.0E-07
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 154 361 7.0E-07
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 196 586 8.0E-07
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 497 588 9.0E-07
sp|O62787|GTR3_PIG Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Sus scrofa GN=SLC2A3 PE=2 SV=1 233 336 1.0E-06
sp|Q9Y694|S22A7_HUMAN Solute carrier family 22 member 7 OS=Homo sapiens GN=SLC22A7 PE=1 SV=1 134 527 2.0E-06
sp|Q1RPP5|S22A7_PIG Solute carrier family 22 member 7 OS=Sus scrofa GN=SLC22A7 PE=2 SV=1 184 527 2.0E-06
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 498 592 2.0E-06
sp|Q3YAW7|S22A7_RABIT Solute carrier family 22 member 7 OS=Oryctolagus cuniculus GN=SLC22A7 PE=2 SV=1 161 543 3.0E-06
sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 154 344 5.0E-06
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 154 344 6.0E-06
sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=1 SV=1 154 344 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 171 193 22
2 203 222 19
3 229 251 22
4 264 286 22
5 291 313 22
6 389 411 22
7 424 446 22
8 456 478 22
9 485 502 17
10 554 576 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6616
MAAEEKRALEERHQAFAHDDGAAAADDRENQRRRLSQLTDNVAGEIRNPLSGLPRDVLLENVARFHREKGLPADI
LPLLNKGALVAQDPAGYLDLDDLDEHDKRALREEVTHRWKHPWPLYYTIILNSIAAAIQGWDQTGSNGANLSFPA
AFGIPDSPKEICATVDCNRNSWIVGFVNAMPYITIWFFAGWISDPLNDLLGRRGVIFVAAIFSLLAPFGMAVSQS
WGQLAACRMLLGIGMGLKEVTVPVFSAENSPAIIRGGLVMSWQVWTAFGIFLGTCANLAVGKTGAIAWRLQLGSA
FIPAVPLVLGTWFCPESPRWCLKKKKYTKAWESLLRLRNTPLQAARDLYYINCLLEQEEILVQEAGLSPKSNLFT
RFVELFTIPRVRRATWASGIVMIAQQLCGINIISFYSSTIFKQSGISDYTALWASFGFGLINFVFAWPAVWTIDT
FGRRALLLFTFPNMFWTLLAAGLCFLIEPNNETSTARIAAVATFVYLFAAFYSPGEGPVPFMYSAEVFPLSHREV
GMSWAVATNNFWASVLSLTFPRMLIAMSSAGAFCFYAGLNILALVLIFLFVPETKQKTLEELDYVFAVPSRKHAS
YQLLTVLPWWVRRWLLFRRGEACPDLYHDADEGGVKG*
Coding >Hirsu2|6616
ATGGCCGCCGAAGAGAAGAGGGCGCTGGAGGAGCGCCATCAGGCCTTCGCGCACGACGACGGCGCCGCCGCCGCC
GACGACCGCGAGAACCAGCGCCGGCGCCTCAGCCAGCTGACGGACAACGTCGCCGGCGAGATCCGCAACCCGCTC
AGCGGCCTGCCGCGCGACGTGCTGCTGGAAAACGTGGCGCGCTTCCACCGCGAAAAGGGCCTGCCGGCCGACATC
CTGCCGCTGCTCAACAAGGGCGCCCTCGTTGCCCAGGACCCGGCCGGCTACCTCGACCTCGACGACCTCGACGAG
CACGACAAGCGCGCCCTGCGCGAGGAGGTCACCCACCGCTGGAAGCACCCCTGGCCGCTCTACTACACCATCATC
CTCAACTCCATCGCCGCCGCCATCCAGGGATGGGACCAGACCGGCTCCAACGGCGCCAACCTCAGCTTCCCCGCC
GCCTTCGGCATCCCCGACTCTCCCAAGGAGATCTGCGCCACCGTCGACTGCAACCGCAACAGCTGGATCGTCGGC
TTCGTCAACGCCATGCCCTACATCACCATCTGGTTCTTCGCCGGATGGATCTCGGACCCCCTCAACGACCTGTTG
GGACGCCGCGGCGTCATCTTCGTCGCCGCCATCTTCTCCCTCCTCGCCCCCTTTGGCATGGCCGTCTCCCAGTCC
TGGGGGCAGCTGGCTGCTTGCCGAATGCTGCTCGGCATCGGAATGGGCCTCAAGGAAGTCACGGTCCCGGTCTTC
TCCGCCGAGAACTCACCCGCCATCATCCGCGGAGGCCTGGTCATGTCGTGGCAGGTCTGGACCGCCTTTGGCATC
TTCCTCGGCACCTGCGCCAACCTGGCCGTCGGCAAGACGGGCGCGATCGCCTGGCGGCTTCAGCTCGGCTCCGCC
TTCATCCCCGCCGTGCCGCTCGTCCTCGGCACCTGGTTCTGCCCCGAGAGCCCACGGTGGTGCCTCAAGAAGAAA
AAGTACACCAAGGCCTGGGAGTCGCTGCTGCGGCTGCGCAACACGCCGCTCCAGGCCGCCCGCGACCTGTACTAC
ATCAACTGCCTGCTGGAGCAGGAGGAGATCCTGGTCCAGGAGGCCGGCCTCAGCCCCAAGAGCAATCTGTTCACC
CGCTTCGTCGAGCTCTTCACCATCCCCCGCGTCCGCCGCGCCACCTGGGCCTCGGGCATCGTCATGATTGCCCAG
CAGCTGTGCGGCATCAACATCATCTCCTTCTACAGCAGCACCATCTTCAAGCAGAGCGGCATCTCCGACTACACG
GCGCTGTGGGCCAGCTTCGGCTTCGGCCTCATCAACTTCGTCTTCGCCTGGCCCGCCGTCTGGACCATCGACACC
TTCGGCCGCCGCGCGCTCCTGCTCTTCACCTTCCCCAACATGTTCTGGACTCTGCTCGCCGCCGGCCTCTGCTTC
CTCATCGAGCCCAACAACGAGACGAGCACGGCGCGGATCGCGGCCGTCGCCACCTTTGTCTACCTGTTTGCCGCC
TTTTACTCGCCCGGCGAGGGTCCCGTCCCCTTCATGTACTCGGCCGAGGTGTTCCCGCTGTCGCACCGCGAGGTG
GGCATGTCGTGGGCGGTGGCGACGAACAACTTCTGGGCGTCGGTGCTGTCGCTGACGTTCCCGCGAATGCTCATC
GCCATGTCCTCGGCCGGCGCCTTCTGCTTCTACGCCGGCCTCAACATCCTGGCCCTGGTGCTCATCTTCCTCTTC
GTGCCGGAGACGAAGCAGAAGACGCTCGAGGAGCTGGACTACGTCTTCGCCGTCCCGAGCCGCAAGCACGCCTCT
TACCAGCTGCTGACCGTCCTGCCCTGGTGGGTCCGCCGCTGGCTGCTCTTCCGCCGCGGCGAGGCCTGCCCGGAT
CTGTACCACGACGCCGACGAGGGGGGCGTCAAGGGCTGA
Transcript >Hirsu2|6616
ATGGCCGCCGAAGAGAAGAGGGCGCTGGAGGAGCGCCATCAGGCCTTCGCGCACGACGACGGCGCCGCCGCCGCC
GACGACCGCGAGAACCAGCGCCGGCGCCTCAGCCAGCTGACGGACAACGTCGCCGGCGAGATCCGCAACCCGCTC
AGCGGCCTGCCGCGCGACGTGCTGCTGGAAAACGTGGCGCGCTTCCACCGCGAAAAGGGCCTGCCGGCCGACATC
CTGCCGCTGCTCAACAAGGGCGCCCTCGTTGCCCAGGACCCGGCCGGCTACCTCGACCTCGACGACCTCGACGAG
CACGACAAGCGCGCCCTGCGCGAGGAGGTCACCCACCGCTGGAAGCACCCCTGGCCGCTCTACTACACCATCATC
CTCAACTCCATCGCCGCCGCCATCCAGGGATGGGACCAGACCGGCTCCAACGGCGCCAACCTCAGCTTCCCCGCC
GCCTTCGGCATCCCCGACTCTCCCAAGGAGATCTGCGCCACCGTCGACTGCAACCGCAACAGCTGGATCGTCGGC
TTCGTCAACGCCATGCCCTACATCACCATCTGGTTCTTCGCCGGATGGATCTCGGACCCCCTCAACGACCTGTTG
GGACGCCGCGGCGTCATCTTCGTCGCCGCCATCTTCTCCCTCCTCGCCCCCTTTGGCATGGCCGTCTCCCAGTCC
TGGGGGCAGCTGGCTGCTTGCCGAATGCTGCTCGGCATCGGAATGGGCCTCAAGGAAGTCACGGTCCCGGTCTTC
TCCGCCGAGAACTCACCCGCCATCATCCGCGGAGGCCTGGTCATGTCGTGGCAGGTCTGGACCGCCTTTGGCATC
TTCCTCGGCACCTGCGCCAACCTGGCCGTCGGCAAGACGGGCGCGATCGCCTGGCGGCTTCAGCTCGGCTCCGCC
TTCATCCCCGCCGTGCCGCTCGTCCTCGGCACCTGGTTCTGCCCCGAGAGCCCACGGTGGTGCCTCAAGAAGAAA
AAGTACACCAAGGCCTGGGAGTCGCTGCTGCGGCTGCGCAACACGCCGCTCCAGGCCGCCCGCGACCTGTACTAC
ATCAACTGCCTGCTGGAGCAGGAGGAGATCCTGGTCCAGGAGGCCGGCCTCAGCCCCAAGAGCAATCTGTTCACC
CGCTTCGTCGAGCTCTTCACCATCCCCCGCGTCCGCCGCGCCACCTGGGCCTCGGGCATCGTCATGATTGCCCAG
CAGCTGTGCGGCATCAACATCATCTCCTTCTACAGCAGCACCATCTTCAAGCAGAGCGGCATCTCCGACTACACG
GCGCTGTGGGCCAGCTTCGGCTTCGGCCTCATCAACTTCGTCTTCGCCTGGCCCGCCGTCTGGACCATCGACACC
TTCGGCCGCCGCGCGCTCCTGCTCTTCACCTTCCCCAACATGTTCTGGACTCTGCTCGCCGCCGGCCTCTGCTTC
CTCATCGAGCCCAACAACGAGACGAGCACGGCGCGGATCGCGGCCGTCGCCACCTTTGTCTACCTGTTTGCCGCC
TTTTACTCGCCCGGCGAGGGTCCCGTCCCCTTCATGTACTCGGCCGAGGTGTTCCCGCTGTCGCACCGCGAGGTG
GGCATGTCGTGGGCGGTGGCGACGAACAACTTCTGGGCGTCGGTGCTGTCGCTGACGTTCCCGCGAATGCTCATC
GCCATGTCCTCGGCCGGCGCCTTCTGCTTCTACGCCGGCCTCAACATCCTGGCCCTGGTGCTCATCTTCCTCTTC
GTGCCGGAGACGAAGCAGAAGACGCTCGAGGAGCTGGACTACGTCTTCGCCGTCCCGAGCCGCAAGCACGCCTCT
TACCAGCTGCTGACCGTCCTGCCCTGGTGGGTCCGCCGCTGGCTGCTCTTCCGCCGCGGCGAGGCCTGCCCGGAT
CTGTACCACGACGCCGACGAGGGGGGCGTCAAGGGCTGA
Gene >Hirsu2|6616
ATGGCCGCCGAAGAGAAGAGGGCGCTGGAGGAGCGCCATCAGGCCTTGTGAGTGTCGGCTGTCTATCTATCATCA
CCCAGCCCTGGCTGACTGACTCGTCCGGCCAGCGCGCACGACGACGGCGCCGCCGCCGCCGACGACCGCGAGAAC
CAGCGCCGGCGCCTCAGCCAGCTGACGGACAACGTCGCCGGCGAGATCCGCAACCCGCTCAGCGGCCTGCCGCGC
GACGTGCTGCTGGAAAACGTGGCGCGCTTCCACCGCGAAAAGGGCCTGCCGGCCGACATCCTGCCGCTGCTCAAC
AAGGGCGCCCTCGTTGCCCAGGACCCGGCCGGCTACCTCGACCTCGACGACCTCGACGAGCACGACAAGCGCGCC
CTGCGCGAGGAGGTCACCCACCGCTGGAAGCACCCCTGGCCGCTCTACTACACCATCATCCTCAACTCCATCGCC
GCCGCCATCCAGGGATGGGACCAGGTACCGTCTCTCCTCTCTCCTCTGTCTCTCTGTCTCTCTCTCTCTCCATCT
TTCTCTGTCTCCCTATCTCTCTCACTCGCTCACTCTGACCTCCCTCGGCTTGCCAGACCGGCTCCAACGGCGCCA
ACCTCAGCTTCCCCGCCGCCTTCGGCATCCCCGACTCTCCCAAGGAGATCTGCGCCACCGTCGACTGCAACCGCA
ACAGCTGGATCGTCGGCTTCGTCAACGCCATGCCCTACATCACCATCTGGTTCTTGTTCGTCTCTCCTCATCCCC
CTTTGACCCTTAATCATGCCAGCATCCACCCTACTGACATCCTCCCCCCCCCCAGCGCCGGATGGATCTCGGACC
CCCTCAACGACCTGTTGGGACGCCGCGGCGTCATCTTCGTCGCCGCCATCTTCTCCCTCCTCGCCCCCTTTGGCA
TGGCCGTCTCCCAGTCCTGGGGGCAGCTGGCTGCTTGCCGGTGAGTATCCCGCGCACATCCCACCAGGCAAAGCC
GGGCCGCCGCTGACCCGTTGCGCCACAGAATGCTGCTCGGCATCGGAATGGGCCTCAAGGAAGTCACGGTCCCGG
TCTTCTCCGCCGAGAACTCACCCGCCATCATCCGCGGAGGCCTGGTCATGTCGTGGCAGGTCTGGACCGCCTTTG
GTAAGCCATCCCCCCCAACACGCCACGGTCGTCAAACCTCTCTCTCTCTCTCTCTCTCTCCTTGTCCCTCATACC
TGACTCTCTCCTCTTCCTTGCCACTCGCTTCCTCAGGCATCTTCCTCGGCACCTGCGCCAACCTGGCCGTCGGCA
AGACGGGCGCGATCGCCTGGCGGCTTCAGCTCGGCTCCGCCTTCATCCCCGCCGTGCCGCTCGTCCTCGGCACCT
GGTTCTGCCCCGAGAGCCCACGGTGGTGCCTCAAGAAGAAAAAGTACACCAAGGCCTGGGAGTCGCTGCTGCGGC
TGCGCAACACGCCGCTCCAGGCCGCCCGCGACCTGTACTACATCAACTGCCTGCTGGAGCAGGAGGAGATCCTGG
TCCAGGAGGCCGGCCTCAGCCCCAAGAGCAATCTGTTCACCCGCTTCGTCGAGCTCTTCACCATCCCCCGCGTCC
GCCGCGCCACCTGGGCCTCGGGCATCGTCATGATTGCCCAGCAGCTGTGCGGCAGTGAGTAGACCCGGCCCTCGG
CCCCCGTCCGGCGGCCTCCCCACGTCGACCGCCCGAGGGAGAGCACGGCTGACGTGGCAAAAATGTGGCAGTCAA
CATCATCTCCTTCTACAGCAGCACCATCTTCAAGCAGAGCGGCATCTCCGACTACACGGCGCTGTGGGCCAGCTT
CGGCTTCGGCCTCATCAACTTCGTCTTCGCCTGGCCCGCCGTCTGGACCATCGACACCTTCGGCCGCCGCGCGCT
CCTGCTCTTCACCTTCCCCAACATGTTCTGGACTCTGCTCGCCGCCGGCCTCTGCTTCCTCATCGAGCCCAACAA
CGAGACGAGCACGGCGCGGATCGCGGCCGTCGCCACCTTTGTCTACCTGTTTGCCGCCTTTTACTCGCCCGGTAA
GTCCTCGGCGAAGAGAGGAGAGAGAGAGTGTGTGTGTGTGTGTGTCAGAGAAAAAGAAGAAGAAAAAAAGAAACG
GAAAACAGACACAGAGGGAGAGCACTGCTGACGTCGGTCCCCCCAACAGGCGAGGGTCCCGTCCCCTTCATGTAC
TCGGCCGAGGTGTTCCCGCTGTCGCACCGCGAGGTGGGCATGTCGTGGGCGGTGGCGACGAACAACTTCTGGGCG
TCGGTGCTGTCGCTGACGTTCCCGCGAATGCTCATCGCCATGTCCTCGGCCGGCGCCTTCTGCTTCTACGCCGGC
CTCAACATCCTGGCCCTGGTGCTCATCTTCCTCTTCGTGCCGGAGACGAAGCAGAAGACGCTCGAGGAGCTGGAC
TACGTCTTCGCCGTCCCGAGCCGCAAGCACGCCTCTTACCAGCTGCTGACCGTCCTGCCCTGGTGGGTCCGCCGC
TGGCTGCTCTTCCGCCGCGGCGAGGCCTGCCCGGATCTGTACCACGACGCCGACGAGGGGGGCGTCAAGGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail