Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6611
Gene name
LocationContig_344:6669..9227
Strand+
Gene length (bp)2558
Transcript length (bp)2022
Coding sequence length (bp)2022
Protein length (aa) 674

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 5.9E-05 619 663

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AVW3|LYSM5_ARTBC LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00327 PE=3 SV=2 309 665 2.0E-20
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 271 666 7.0E-19
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 306 666 3.0E-11
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 552 668 3.0E-09
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 611 665 9.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AVW3|LYSM5_ARTBC LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00327 PE=3 SV=2 309 665 2.0E-20
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 271 666 7.0E-19
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 306 666 3.0E-11
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 552 668 3.0E-09
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 611 665 9.0E-09
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 604 663 1.0E-07
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 523 665 3.0E-07
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 222 388 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6611
MAVHRGGSWLSLGLLLVFGIWVEALAFLPTLDGSAFHLGIPDQLSTPCQTAFNQTTQCNATLGAVAFNGFFPSSD
QLTLICTKDCLESLENVRSKQVESCSTESYTVDGKAVPATYDVDRLLFTYNYTCLRDGITKDFCAPLVDEWSQNE
EPTSNQSCSDCMLHTFQVELNSPFGYDSEFASYYTSLTSSCGVTDYPIISPTPYTVSRTATTTSPSASASESCAS
RYNAKEGDDCLSVSKSQRVSTAMLRFQNGIAADCSNFPEAGTSLCIPESCEPYTLLANETCRGISEAHNASFTMT
QLISWNPDINRDCSNLEALTGTQLCISAPGDSTEPDVASATSTTVGPVPAPTNVVDGTNLRCGKYYQVALGDTCA
SISVTMGISLRDFYFLVSTTRDCFSPVANSADAGARIPRSIATVPIYWPDTPTASRRLAISQPIPDTVPPSCLAT
SVSTASDWTFPSFTTTKATKPTPLPLAPGTLSNCSEYAEYITARQKSSAINACNVVASFYDVADTKRTADVDDFV
SWNPSLSYDAKHWLDCQLKPGYLYCAHPALPKAATTSMSTSSASMTATMSSFSKGAASSASTTSATPPSRTGSNG
EPTPLPIQAGMTSACGGFYLVKPGDGCYDIASANEIALADLYSWNPALKGDCSGLYYGYYICIGLLSRTATSS*
Coding >Hirsu2|6611
ATGGCTGTCCACCGCGGGGGCTCATGGTTGTCACTTGGGCTTCTGCTTGTGTTTGGCATATGGGTAGAAGCGCTG
GCCTTTCTGCCAACCCTGGATGGCAGTGCATTTCATTTAGGAATCCCGGACCAGCTCTCCACACCCTGCCAGACG
GCATTCAACCAGACTACTCAGTGCAATGCCACGCTGGGAGCTGTCGCGTTCAATGGCTTCTTCCCCTCAAGCGAC
CAGTTGACTCTCATCTGTACGAAAGACTGCCTCGAATCTCTGGAGAATGTTCGCTCCAAGCAGGTCGAGTCCTGT
TCGACGGAGTCTTATACCGTCGACGGGAAAGCCGTTCCGGCCACCTACGACGTGGACCGATTGCTTTTCACCTAC
AATTACACCTGTTTGCGAGATGGAATCACCAAGGACTTCTGCGCTCCTCTTGTCGATGAATGGTCACAAAATGAG
GAGCCAACGTCCAACCAGTCCTGCTCCGATTGCATGTTGCACACTTTCCAGGTAGAACTTAACTCGCCATTCGGT
TACGATAGCGAGTTTGCTAGCTACTACACCTCCCTTACCTCTTCCTGTGGAGTCACAGACTACCCGATCATCTCG
CCGACTCCCTACACCGTATCGAGGACGGCGACAACGACGTCTCCATCTGCCAGCGCCTCAGAAAGTTGTGCATCC
AGATACAATGCCAAGGAGGGAGATGACTGCCTCAGCGTCAGTAAGTCGCAGCGTGTGTCGACGGCGATGTTGCGA
TTCCAGAACGGCATCGCCGCCGACTGTTCTAATTTTCCAGAGGCCGGAACGTCCCTCTGCATACCCGAGAGCTGT
GAGCCTTATACGCTTCTGGCGAATGAGACCTGTCGTGGCATCAGTGAGGCACATAACGCTAGTTTCACAATGACC
CAGCTCATCTCATGGAACCCCGACATCAACCGCGATTGCAGCAATTTGGAAGCGTTGACAGGGACTCAACTCTGC
ATCAGTGCACCTGGAGACTCGACAGAGCCAGACGTCGCCTCAGCTACTTCGACGACTGTGGGACCAGTCCCCGCG
CCGACAAATGTGGTAGACGGGACCAATCTTCGGTGCGGTAAGTACTACCAAGTAGCTCTGGGCGATACTTGCGCT
TCCATCAGCGTGACGATGGGCATCAGCCTCCGTGACTTTTACTTCTTGGTAAGTACAACCCGGGACTGTTTTTCT
CCGGTTGCCAACTCGGCTGATGCTGGCGCCAGAATCCCGAGGTCAATAGCGACTGTACCAATCTACTGGCCGGAT
ACTCCTACTGCGTCCAGGCGGTTGGCAATATCGCAACCTATTCCGGACACAGTCCCCCCTAGCTGCTTGGCCACA
AGCGTATCCACCGCCTCTGACTGGACGTTCCCGTCATTCACCACCACCAAGGCCACCAAGCCGACGCCGCTGCCC
CTGGCTCCAGGAACGCTCTCCAATTGCTCAGAATACGCGGAGTACATCACAGCAAGGCAAAAGTCGTCGGCCATT
AATGCATGCAATGTTGTGGCGAGCTTCTATGATGTGGCTGACACAAAAAGGACAGCGGACGTTGACGACTTTGTG
TCGTGGAATCCATCACTATCGTACGATGCCAAACACTGGCTCGACTGCCAGCTCAAGCCAGGCTATCTGTACTGT
GCCCATCCGGCTCTGCCAAAGGCAGCTACTACGTCCATGTCCACGTCGTCGGCATCGATGACAGCCACGATGTCT
TCTTTCAGCAAGGGGGCTGCCTCATCGGCATCGACGACATCCGCGACGCCTCCTTCGAGGACGGGGTCCAACGGT
GAACCAACGCCACTACCCATCCAGGCGGGCATGACGTCAGCATGCGGTGGGTTCTATCTTGTCAAGCCCGGCGAC
GGCTGCTACGACATCGCTTCGGCAAACGAGATAGCTCTCGCAGACCTTTACTCGTGGAACCCAGCCCTGAAGGGT
GACTGCTCTGGCTTGTACTACGGCTATTACATCTGTATCGGCTTGCTCTCCCGCACCGCCACTTCTTCCTGA
Transcript >Hirsu2|6611
ATGGCTGTCCACCGCGGGGGCTCATGGTTGTCACTTGGGCTTCTGCTTGTGTTTGGCATATGGGTAGAAGCGCTG
GCCTTTCTGCCAACCCTGGATGGCAGTGCATTTCATTTAGGAATCCCGGACCAGCTCTCCACACCCTGCCAGACG
GCATTCAACCAGACTACTCAGTGCAATGCCACGCTGGGAGCTGTCGCGTTCAATGGCTTCTTCCCCTCAAGCGAC
CAGTTGACTCTCATCTGTACGAAAGACTGCCTCGAATCTCTGGAGAATGTTCGCTCCAAGCAGGTCGAGTCCTGT
TCGACGGAGTCTTATACCGTCGACGGGAAAGCCGTTCCGGCCACCTACGACGTGGACCGATTGCTTTTCACCTAC
AATTACACCTGTTTGCGAGATGGAATCACCAAGGACTTCTGCGCTCCTCTTGTCGATGAATGGTCACAAAATGAG
GAGCCAACGTCCAACCAGTCCTGCTCCGATTGCATGTTGCACACTTTCCAGGTAGAACTTAACTCGCCATTCGGT
TACGATAGCGAGTTTGCTAGCTACTACACCTCCCTTACCTCTTCCTGTGGAGTCACAGACTACCCGATCATCTCG
CCGACTCCCTACACCGTATCGAGGACGGCGACAACGACGTCTCCATCTGCCAGCGCCTCAGAAAGTTGTGCATCC
AGATACAATGCCAAGGAGGGAGATGACTGCCTCAGCGTCAGTAAGTCGCAGCGTGTGTCGACGGCGATGTTGCGA
TTCCAGAACGGCATCGCCGCCGACTGTTCTAATTTTCCAGAGGCCGGAACGTCCCTCTGCATACCCGAGAGCTGT
GAGCCTTATACGCTTCTGGCGAATGAGACCTGTCGTGGCATCAGTGAGGCACATAACGCTAGTTTCACAATGACC
CAGCTCATCTCATGGAACCCCGACATCAACCGCGATTGCAGCAATTTGGAAGCGTTGACAGGGACTCAACTCTGC
ATCAGTGCACCTGGAGACTCGACAGAGCCAGACGTCGCCTCAGCTACTTCGACGACTGTGGGACCAGTCCCCGCG
CCGACAAATGTGGTAGACGGGACCAATCTTCGGTGCGGTAAGTACTACCAAGTAGCTCTGGGCGATACTTGCGCT
TCCATCAGCGTGACGATGGGCATCAGCCTCCGTGACTTTTACTTCTTGGTAAGTACAACCCGGGACTGTTTTTCT
CCGGTTGCCAACTCGGCTGATGCTGGCGCCAGAATCCCGAGGTCAATAGCGACTGTACCAATCTACTGGCCGGAT
ACTCCTACTGCGTCCAGGCGGTTGGCAATATCGCAACCTATTCCGGACACAGTCCCCCCTAGCTGCTTGGCCACA
AGCGTATCCACCGCCTCTGACTGGACGTTCCCGTCATTCACCACCACCAAGGCCACCAAGCCGACGCCGCTGCCC
CTGGCTCCAGGAACGCTCTCCAATTGCTCAGAATACGCGGAGTACATCACAGCAAGGCAAAAGTCGTCGGCCATT
AATGCATGCAATGTTGTGGCGAGCTTCTATGATGTGGCTGACACAAAAAGGACAGCGGACGTTGACGACTTTGTG
TCGTGGAATCCATCACTATCGTACGATGCCAAACACTGGCTCGACTGCCAGCTCAAGCCAGGCTATCTGTACTGT
GCCCATCCGGCTCTGCCAAAGGCAGCTACTACGTCCATGTCCACGTCGTCGGCATCGATGACAGCCACGATGTCT
TCTTTCAGCAAGGGGGCTGCCTCATCGGCATCGACGACATCCGCGACGCCTCCTTCGAGGACGGGGTCCAACGGT
GAACCAACGCCACTACCCATCCAGGCGGGCATGACGTCAGCATGCGGTGGGTTCTATCTTGTCAAGCCCGGCGAC
GGCTGCTACGACATCGCTTCGGCAAACGAGATAGCTCTCGCAGACCTTTACTCGTGGAACCCAGCCCTGAAGGGT
GACTGCTCTGGCTTGTACTACGGCTATTACATCTGTATCGGCTTGCTCTCCCGCACCGCCACTTCTTCCTGA
Gene >Hirsu2|6611
ATGGCTGTCCACCGCGGGGGCTCATGGTTGTCACTTGGGCTTCTGCTTGTGTTTGGCATATGGGTAGAAGCGCTG
GCCTTTCTGCCAACCCTGGATGGCAGTGCATTTCATTTAGGAATCCCGGACCAGCTCTCCACACCCTGCCAGTGA
GTATGGAAAGGGGGGGAGGCGGAGAGTTATATCAATATAGGGAAAGACAACATATACTGACTTGCTCAATCCCCT
CCAGGACGGCATTCAACCAGACTACTCAGTGCAATGCCACGCTGGGAGCTGTCGCGTTCAATGGCTTCTTCCCCT
CAAGCGACCAGTTGACTCTCATCTGTACGAAAGACTGCCTCGAATCTCTGGAGAATGTTCGCTCCAAGCAGGTCG
AGTCCTGTTCGACGGAGTCTTATACCGTCGACGGGAAAGCCGTTCCGGCCACCTACGACGTGGACCGATTGCTTT
TCACCTACAATTACACCTGTTTGCGAGATGGGTAAGATTTATTTCTTCTCCCACCCCAGAAAGTTACTGGTTCTA
ACATATTGGAAGAATCACCAAGGACTTCTGCGCTCCTCTTGTCGATGAATGGTCACAAAATGAGGAGCCAACGTC
CAACCAGTCCTGCTCCGATTGCATGTTGCACACTTTCCAGGTAGAACTTAACTCGCCATTCGGTTACGATAGCGA
GTTTGCTAGCTACTACACCTCCCTTACCTCTTCGTATGCGAATATGGGACCGCTCTCTCGTTATATTCCGATACT
GATGCCTCTTCAGCTGTGGAGTCACAGACTACCCGATCATCTCGCCGACTCCCTACACCGTATCGAGGACGGCGA
CAACGACGTCTCCATCTGCCAGCGCCTCAGAAAGTTGTGCATCCAGATACAATGCCAAGGAGGGAGATGACTGCC
TCAGCGTCAGTAAGTCGCAGCGTGTGTCGACGGCGATGTTGCGATTCCAGAACGGCATCGCCGCCGACTGTTCTA
ATTTTCCAGAGGCCGGAACGTCCCTCTGCATACCCGAGAGCTGTGAGCCTTATACGCTTCTGGCGAATGAGACCT
GTCGTGGCATCAGTGAGGCACATAACGCTAGTTTCACAATGACCCAGCTCATCTCATGGAACCCCGACATCAACC
GCGATTGCAGCAATTTGGAAGCGTTGACAGGGACTCAACTCTGCATCAGGTATAACGGGTCTCGCGGGGTATTCG
ATTCGCTCTGTCGTGGTACTGATAGCTGTTCGCAGTGCACCTGGAGACTCGACAGAGCCAGACGTCGCCTCAGCT
ACTTCGACGACTGTGGGACCAGTGTACGTGCAGTATCGCCATCAAGTCCCCTGCCATGGCTTTCATTGAACGCAT
TCTTACCACTTTTCAGCCCCGCGCCGACAAATGTGGTAGACGGGACCAATCTTCGGTGCGGTAAGTACTACCAAG
TAGCTCTGGGCGATACTTGCGCTTCCATCAGCGTGACGATGGGCATCAGCCTCCGTGACTTTTACTTCTTGGTAA
GTACAACCCGGGACTGTTTTTCTCCGGTTGCCAACTCGGCTGATGCTGGCGCCAGAATCCCGAGGTCAATAGCGA
CTGTACCAATCTACTGGCCGGATACTCCTACTGCGTCCAGGCGGTTGGCAATATCGCAACCTATTCCGGACACAG
GTAAGTTCATTCCAGCCCCCCCACCCCCCCCCCCCGCCCGCAGGACCTCGCTGACTGAGACGTACTCAGCGGAAG
TGTAAACCCCTGCCATAAGACTTTTCCAGTCCCCCCTAGCTGCTTGGCCACAAGCGTATCCACCGCCTCTGACTG
GACGTTCCCGTCATTCACCACCACCAAGGCCACCAAGCCGACGCCGCTGCCCCTGGCTCCAGGAACGCTCTCCAA
TTGCTCAGAATACGCGGAGTACATCACAGCAAGGCAAAAGTCGTCGGCCATTAATGCATGCAATGTTGTGGCGAG
CTTCTATGATGGTAAGAATCGCAGCCAGTCCAGCAGGCTGGGAACTTGAATGGCCGCAGTGGCTGACACAAAAAG
GACAGCGGACGTTGACGACTTTGTGTCGTGGAATCCATCACTATCGTACGATGCCAAACACTGGCTCGACTGCCA
GCTCAAGCCAGGCTATCTGTACTGTGCCCATCCGGCTCTGCCAAAGGCAGCTACTACGTCCATGTCCACGTCGTC
GGCATCGATGACAGCCACGATGTCTTCTTTCAGCAAGGGGGCTGCCTCATCGGCATCGACGACATCCGCGACGCC
TCCTTCGAGGACGGGGTCCAACGGTGAACCAACGCCACTACCCATCCAGGTACGCCCCTGTCATCACACGTTTCA
TGAGATTAGGGGCGAGTAGCTGAATGTGTGCCAAGGCGGGCATGACGTCAGCATGCGGTGGGTTCTATCTTGTCA
AGCCCGGCGACGGCTGCTACGACATCGCTTCGGCAAACGAGATAGCTCTCGCAGACCTTTACTCGTGGAACCCAG
CCCTGAAGGGTGACTGCTCTGGCTTGTACTACGGCTATTACATCTGTATCGGCTTGCTCTCCCGCACCGCCACTT
CTTCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail