Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6598
Gene name
LocationContig_343:45..1585
Strand-
Gene length (bp)1540
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 7.3E-15 285 354
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.6E-12 390 444

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 272 443 8.0E-48
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 195 436 1.0E-18
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 285 438 1.0E-18
sp|Q9FVQ1|NUCL1_ARATH Nucleolin 1 OS=Arabidopsis thaliana GN=NUCL1 PE=1 SV=1 271 436 7.0E-18
sp|Q9SVM8|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana GN=RBG2 PE=1 SV=1 270 364 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 272 443 8.0E-48
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 195 436 1.0E-18
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 285 438 1.0E-18
sp|Q9FVQ1|NUCL1_ARATH Nucleolin 1 OS=Arabidopsis thaliana GN=NUCL1 PE=1 SV=1 271 436 7.0E-18
sp|Q9SVM8|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana GN=RBG2 PE=1 SV=1 270 364 1.0E-17
sp|Q99020|ROAA_MOUSE Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus GN=Hnrnpab PE=1 SV=1 278 436 2.0E-17
sp|P13383|NUCL_RAT Nucleolin OS=Rattus norvegicus GN=Ncl PE=1 SV=3 246 443 2.0E-17
sp|Q6Z1C0|NUCL1_ORYSJ Nucleolin 1 OS=Oryza sativa subsp. japonica GN=Os08g0192900 PE=2 SV=1 152 436 2.0E-17
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 284 443 4.0E-17
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 285 442 1.0E-16
sp|P09405|NUCL_MOUSE Nucleolin OS=Mus musculus GN=Ncl PE=1 SV=2 246 443 2.0E-16
sp|Q9LIS2|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana GN=RBG4 PE=2 SV=1 281 364 2.0E-16
sp|Q43472|GRP_HORVU Glycine-rich RNA-binding protein blt801 OS=Hordeum vulgare GN=blt801 PE=1 SV=1 286 365 4.0E-16
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 246 443 5.0E-16
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 256 363 6.0E-16
sp|Q9JII5|DAZP1_MOUSE DAZ-associated protein 1 OS=Mus musculus GN=Dazap1 PE=1 SV=2 285 436 1.0E-15
sp|Q96EP5|DAZP1_HUMAN DAZ-associated protein 1 OS=Homo sapiens GN=DAZAP1 PE=1 SV=1 285 436 2.0E-15
sp|Q1PEP5|NUCL2_ARATH Nucleolin 2 OS=Arabidopsis thaliana GN=NUCL2 PE=2 SV=1 271 438 2.0E-15
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 285 442 2.0E-15
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 285 434 2.0E-15
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 285 438 2.0E-15
sp|Q99729|ROAA_HUMAN Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens GN=HNRNPAB PE=1 SV=2 278 436 3.0E-15
sp|P32588|PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUB1 PE=1 SV=4 250 362 4.0E-15
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 285 438 7.0E-15
sp|Q14103|HNRPD_HUMAN Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens GN=HNRNPD PE=1 SV=1 257 436 8.0E-15
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 269 362 9.0E-15
sp|P0CR16|MRD1_CRYNJ Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MRD1 PE=3 SV=1 280 436 9.0E-15
sp|P0CR17|MRD1_CRYNB Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MRD1 PE=3 SV=1 280 436 9.0E-15
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 285 362 1.0E-14
sp|Q5ZI72|HNRDL_CHICK Heterogeneous nuclear ribonucleoprotein D-like OS=Gallus gallus GN=HNRNPDL PE=2 SV=1 242 436 1.0E-14
sp|Q7SG09|MRD1_NEUCR Multiple RNA-binding domain-containing protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrd-1 PE=3 SV=1 283 442 1.0E-14
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 285 436 1.0E-14
sp|Q5BGA9|MRD1_EMENI Multiple RNA-binding domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mrd1 PE=3 SV=1 277 442 1.0E-14
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 267 443 2.0E-14
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 281 438 2.0E-14
sp|Q60668|HNRPD_MOUSE Heterogeneous nuclear ribonucleoprotein D0 OS=Mus musculus GN=Hnrnpd PE=1 SV=2 285 436 2.0E-14
sp|O14979|HNRDL_HUMAN Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens GN=HNRNPDL PE=1 SV=3 285 436 2.0E-14
sp|P48809|RB27C_DROME Heterogeneous nuclear ribonucleoprotein 27C OS=Drosophila melanogaster GN=Hrb27C PE=1 SV=2 285 436 2.0E-14
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus GN=Rbm19 PE=1 SV=1 282 443 2.0E-14
sp|Q4WJT7|MRD1_ASPFU Multiple RNA-binding domain-containing protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrd1 PE=3 SV=1 281 442 2.0E-14
sp|Q9JJ54|HNRPD_RAT Heterogeneous nuclear ribonucleoprotein D0 OS=Rattus norvegicus GN=Hnrnpd PE=1 SV=2 247 436 2.0E-14
sp|Q3SWU3|HNRDL_RAT Heterogeneous nuclear ribonucleoprotein D-like OS=Rattus norvegicus GN=Hnrnpdl PE=1 SV=1 285 436 3.0E-14
sp|Q99070|GRP2_SORBI Glycine-rich RNA-binding protein 2 OS=Sorghum bicolor GN=GRP2 PE=2 SV=1 286 359 3.0E-14
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 282 443 3.0E-14
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 282 443 4.0E-14
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 282 443 4.0E-14
sp|Q9Z130|HNRDL_MOUSE Heterogeneous nuclear ribonucleoprotein D-like OS=Mus musculus GN=Hnrnpdl PE=1 SV=1 285 436 4.0E-14
sp|Q8W034|RNP1_ARATH Heterogeneous nuclear ribonucleoprotein 1 OS=Arabidopsis thaliana GN=RNP1 PE=1 SV=1 285 436 4.0E-14
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 285 436 5.0E-14
sp|O94432|YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.15 PE=3 SV=1 285 436 6.0E-14
sp|Q5RBU8|ROA2_PONAB Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii GN=HNRNPA2B1 PE=2 SV=1 263 436 7.0E-14
sp|Q9LIN3|RZ1A_ARATH Glycine-rich RNA-binding protein RZ1A OS=Arabidopsis thaliana GN=RZ1A PE=1 SV=1 285 357 8.0E-14
sp|O88569|ROA2_MOUSE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus GN=Hnrnpa2b1 PE=1 SV=2 263 436 8.0E-14
sp|P22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens GN=HNRNPA2B1 PE=1 SV=2 263 436 8.0E-14
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 269 362 1.0E-13
sp|A7VJC2|ROA2_RAT Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus GN=Hnrnpa2b1 PE=1 SV=1 263 436 1.0E-13
sp|Q03251|RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=RBG8 PE=1 SV=1 279 357 1.0E-13
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 284 443 2.0E-13
sp|Q98SJ2|DAZP1_XENLA DAZ-associated protein 1 OS=Xenopus laevis GN=dazap1 PE=1 SV=1 285 436 2.0E-13
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 285 443 2.0E-13
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 294 442 2.0E-13
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 284 443 3.0E-13
sp|P39697|RT19_ARATH 40S ribosomal protein S19, mitochondrial OS=Arabidopsis thaliana GN=RPS19 PE=1 SV=2 285 359 3.0E-13
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 269 363 4.0E-13
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 279 443 4.0E-13
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 285 443 4.0E-13
sp|Q9FPJ8|RB45A_ARATH Polyadenylate-binding protein RBP45A OS=Arabidopsis thaliana GN=RBP45A PE=2 SV=1 242 429 4.0E-13
sp|P13383|NUCL_RAT Nucleolin OS=Rattus norvegicus GN=Ncl PE=1 SV=3 284 443 6.0E-13
sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 294 442 6.0E-13
sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 294 442 7.0E-13
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 279 363 8.0E-13
sp|Q6CEW9|MRD1_YARLI Multiple RNA-binding domain-containing protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRD1 PE=3 SV=1 281 442 1.0E-12
sp|Q9SX80|R47CP_ARATH Polyadenylate-binding protein RBP47C' OS=Arabidopsis thaliana GN=RBP47C' PE=2 SV=1 275 436 1.0E-12
sp|Q03878|GRP1_DAUCA Glycine-rich RNA-binding protein OS=Daucus carota PE=2 SV=1 279 357 1.0E-12
sp|Q9SX79|RB47C_ARATH Polyadenylate-binding protein RBP47C OS=Arabidopsis thaliana GN=RBP47C PE=2 SV=1 275 436 1.0E-12
sp|P51990|RO22_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 2 OS=Xenopus laevis PE=2 SV=1 280 436 1.0E-12
sp|Q7ZX83|HNDLA_XENLA Heterogeneous nuclear ribonucleoprotein D-like-A OS=Xenopus laevis GN=hnrnpdl-a PE=2 SV=1 278 436 2.0E-12
sp|P49311|GRP2_SINAL Glycine-rich RNA-binding protein GRP2A OS=Sinapis alba PE=2 SV=1 286 357 2.0E-12
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 283 442 2.0E-12
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 285 438 3.0E-12
sp|P51989|RO21_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 1 OS=Xenopus laevis PE=2 SV=1 280 436 3.0E-12
sp|Q9TTV2|ROA2_SAGOE Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Saguinus oedipus GN=HNRNPA2B1 PE=1 SV=1 280 436 3.0E-12
sp|Q43349|CP29A_ARATH 29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP29A PE=2 SV=2 285 362 3.0E-12
sp|Q03250|RBG7_ARATH Glycine-rich RNA-binding protein 7 OS=Arabidopsis thaliana GN=RBG7 PE=1 SV=1 286 357 3.0E-12
sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 285 443 4.0E-12
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 285 368 4.0E-12
sp|Q6NU14|HNDLB_XENLA Heterogeneous nuclear ribonucleoprotein D-like-B OS=Xenopus laevis GN=hnrnpdl-b PE=2 SV=1 283 436 4.0E-12
sp|Q2HJ60|ROA2_BOVIN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Bos taurus GN=HNRNPA2B1 PE=2 SV=1 280 436 5.0E-12
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 247 359 6.0E-12
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 247 359 6.0E-12
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 247 359 6.0E-12
sp|P17130|ROA1_XENLA Heterogeneous nuclear ribonucleoproteins A1 homolog OS=Xenopus laevis GN=hnrnpa1 PE=2 SV=1 280 436 6.0E-12
sp|P48810|RB87F_DROME Heterogeneous nuclear ribonucleoprotein 87F OS=Drosophila melanogaster GN=Hrb87F PE=2 SV=2 280 436 6.0E-12
sp|F4I3B3|RB47A_ARATH Polyadenylate-binding protein RBP47A OS=Arabidopsis thaliana GN=RBP47A PE=2 SV=1 284 436 6.0E-12
sp|Q05966|GRP10_BRANA Glycine-rich RNA-binding protein 10 OS=Brassica napus GN=GRP10 PE=2 SV=1 279 357 7.0E-12
sp|P13383|NUCL_RAT Nucleolin OS=Rattus norvegicus GN=Ncl PE=1 SV=3 240 359 8.0E-12
sp|P07909|ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster GN=Hrb98DE PE=2 SV=1 268 436 8.0E-12
sp|Q0WW84|RB47B_ARATH Polyadenylate-binding protein RBP47B OS=Arabidopsis thaliana GN=RBP47B PE=2 SV=1 269 436 8.0E-12
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 240 359 9.0E-12
sp|P10979|GRPA_MAIZE Glycine-rich RNA-binding, abscisic acid-inducible protein OS=Zea mays GN=RAB15 PE=1 SV=1 286 359 9.0E-12
sp|Q640A2|HNRDL_XENTR Heterogeneous nuclear ribonucleoprotein D-like OS=Xenopus tropicalis GN=hnrnpdl PE=2 SV=1 263 436 9.0E-12
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 285 356 1.0E-11
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 294 442 1.0E-11
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 294 442 1.0E-11
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 275 443 1.0E-11
sp|P49310|GRP1_SINAL Glycine-rich RNA-binding protein GRP1A OS=Sinapis alba PE=2 SV=1 286 357 1.0E-11
sp|Q54PB2|MRD1_DICDI Multiple RNA-binding domain-containing protein 1 OS=Dictyostelium discoideum GN=mrd1 PE=3 SV=1 285 443 1.0E-11
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 269 362 2.0E-11
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 294 442 2.0E-11
sp|P09405|NUCL_MOUSE Nucleolin OS=Mus musculus GN=Ncl PE=1 SV=2 247 359 3.0E-11
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 285 356 3.0E-11
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 279 359 3.0E-11
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 294 442 4.0E-11
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 294 442 5.0E-11
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 294 442 5.0E-11
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 249 445 5.0E-11
sp|Q9LJH8|UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana GN=UBP1C PE=1 SV=1 277 436 5.0E-11
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 280 367 6.0E-11
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 284 359 7.0E-11
sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 285 443 7.0E-11
sp|P29341|PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus GN=Pabpc1 PE=1 SV=2 285 443 7.0E-11
sp|Q8VXZ9|R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana GN=RBP47B' PE=2 SV=1 277 436 7.0E-11
sp|Q9EPH8|PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus GN=Pabpc1 PE=1 SV=1 285 443 8.0E-11
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 281 436 8.0E-11
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 285 363 9.0E-11
sp|P51991|ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens GN=HNRNPA3 PE=1 SV=2 280 436 9.0E-11
sp|Q6URK4|ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus GN=Hnrnpa3 PE=1 SV=1 280 436 9.0E-11
sp|Q8BG05|ROA3_MOUSE Heterogeneous nuclear ribonucleoprotein A3 OS=Mus musculus GN=Hnrnpa3 PE=1 SV=1 280 436 9.0E-11
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 285 359 9.0E-11
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 285 362 1.0E-10
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 270 442 1.0E-10
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 285 363 1.0E-10
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 285 363 1.0E-10
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 272 442 1.0E-10
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 285 359 1.0E-10
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 294 442 1.0E-10
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 285 362 2.0E-10
sp|Q8VXZ9|R47BP_ARATH Polyadenylate-binding protein RBP47B' OS=Arabidopsis thaliana GN=RBP47B' PE=2 SV=1 285 436 2.0E-10
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 285 359 2.0E-10
sp|O74400|YOCE_SCHPO Uncharacterized RNA-binding protein C4F6.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.14 PE=1 SV=1 283 434 2.0E-10
sp|Q6CQR6|MRD1_KLULA Multiple RNA-binding domain-containing protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRD1 PE=3 SV=1 284 436 2.0E-10
sp|Q9FZ84|RBG6_ARATH Glycine-rich RNA-binding protein 6, mitochondrial OS=Arabidopsis thaliana GN=RBG6 PE=2 SV=1 262 357 2.0E-10
sp|Q5M9F1|RBM34_RAT RNA-binding protein 34 OS=Rattus norvegicus GN=Rbm34 PE=1 SV=1 284 356 2.0E-10
sp|Q99383|HRP1_YEAST Nuclear polyadenylated RNA-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRP1 PE=1 SV=1 255 436 2.0E-10
sp|Q4PC17|MRD1_USTMA Multiple RNA-binding domain-containing protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MRD1 PE=3 SV=1 283 445 2.0E-10
sp|Q10355|YDB2_SCHPO Uncharacterized RNA-binding protein C22E12.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.02 PE=3 SV=1 285 383 2.0E-10
sp|P51992|RO32_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 2 OS=Xenopus laevis PE=2 SV=1 280 436 2.0E-10
sp|Q5R8F7|PABP1_PONAB Polyadenylate-binding protein 1 OS=Pongo abelii GN=PABPC1 PE=2 SV=1 285 443 3.0E-10
sp|P11940|PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 285 443 3.0E-10
sp|P61286|PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus GN=PABPC1 PE=2 SV=1 285 443 3.0E-10
sp|Q9VVE5|MSIR6_DROME RNA-binding protein Musashi homolog Rbp6 OS=Drosophila melanogaster GN=Rbp6 PE=2 SV=3 285 445 3.0E-10
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 285 362 4.0E-10
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 280 436 4.0E-10
sp|Q8C5L7|RBM34_MOUSE RNA-binding protein 34 OS=Mus musculus GN=Rbm34 PE=1 SV=1 284 356 4.0E-10
sp|O43347|MSI1H_HUMAN RNA-binding protein Musashi homolog 1 OS=Homo sapiens GN=MSI1 PE=1 SV=1 285 445 4.0E-10
sp|O13620|MRD1_SCHPO Multiple RNA-binding domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrd1 PE=3 SV=1 270 442 5.0E-10
sp|P09405|NUCL_MOUSE Nucleolin OS=Mus musculus GN=Ncl PE=1 SV=2 284 443 6.0E-10
sp|Q9C909|RBG5_ARATH Glycine-rich RNA-binding protein 5, mitochondrial OS=Arabidopsis thaliana GN=RBG5 PE=2 SV=1 267 359 6.0E-10
sp|Q61474|MSI1H_MOUSE RNA-binding protein Musashi homolog 1 OS=Mus musculus GN=Msi1 PE=1 SV=1 285 445 6.0E-10
sp|Q6FXP4|MRD1_CANGA Multiple RNA-binding domain-containing protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRD1 PE=3 SV=1 284 436 6.0E-10
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 285 359 6.0E-10
sp|Q8K3P4|MSI1H_RAT RNA-binding protein Musashi homolog 1 OS=Rattus norvegicus GN=Msi1 PE=2 SV=1 285 445 7.0E-10
sp|Q08473|SQD_DROME RNA-binding protein squid OS=Drosophila melanogaster GN=sqd PE=1 SV=3 285 436 7.0E-10
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 283 443 8.0E-10
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 282 443 9.0E-10
sp|P53883|NOP13_YEAST Nucleolar protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP13 PE=1 SV=2 322 436 9.0E-10
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 285 367 9.0E-10
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 282 443 1.0E-09
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 282 443 1.0E-09
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 276 436 1.0E-09
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 281 442 1.0E-09
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 294 442 1.0E-09
sp|Q9CX86|ROA0_MOUSE Heterogeneous nuclear ribonucleoprotein A0 OS=Mus musculus GN=Hnrnpa0 PE=1 SV=1 276 436 1.0E-09
sp|P21522|ROA1_SCHAM Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog OS=Schistocerca americana GN=HNRNP PE=2 SV=1 280 436 1.0E-09
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 261 442 2.0E-09
sp|Q9SYG4|UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 274 442 2.0E-09
sp|Q9LEB3|RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia GN=RBP47 PE=1 SV=1 284 436 2.0E-09
sp|Q13151|ROA0_HUMAN Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens GN=HNRNPA0 PE=1 SV=1 276 436 2.0E-09
sp|Q09100|RNP24_SCHPO RNA-binding protein rnp24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnp24 PE=3 SV=2 322 445 2.0E-09
sp|Q9SAB3|RB45B_ARATH Polyadenylate-binding protein RBP45B OS=Arabidopsis thaliana GN=RBP45B PE=1 SV=1 284 429 2.0E-09
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 284 436 3.0E-09
sp|Q06106|MRD1_YEAST Multiple RNA-binding domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRD1 PE=1 SV=1 284 436 3.0E-09
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 281 443 3.0E-09
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 284 356 3.0E-09
sp|Q28F51|TADBP_XENTR TAR DNA-binding protein 43 OS=Xenopus tropicalis GN=tardbp PE=2 SV=1 272 436 3.0E-09
sp|Q93W34|RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana GN=RBP45C PE=2 SV=1 284 429 3.0E-09
sp|Q5R5W2|TADBP_PONAB TAR DNA-binding protein 43 OS=Pongo abelii GN=TARDBP PE=2 SV=1 285 436 3.0E-09
sp|Q43349|CP29A_ARATH 29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP29A PE=2 SV=2 285 357 4.0E-09
sp|Q9H361|PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 285 443 4.0E-09
sp|P09651|ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 280 436 4.0E-09
sp|Q13148|TADBP_HUMAN TAR DNA-binding protein 43 OS=Homo sapiens GN=TARDBP PE=1 SV=1 285 436 4.0E-09
sp|Q9NW13|RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens GN=RBM28 PE=1 SV=3 281 442 4.0E-09
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 283 442 5.0E-09
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 239 445 6.0E-09
sp|Q8C5L7|RBM34_MOUSE RNA-binding protein 34 OS=Mus musculus GN=Rbm34 PE=1 SV=1 267 436 7.0E-09
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 239 443 7.0E-09
sp|Q02926|RB97D_DROME Ribonucleoprotein RB97D OS=Drosophila melanogaster GN=Rb97D PE=2 SV=1 280 436 7.0E-09
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 285 443 7.0E-09
sp|A5A6H4|ROA1_PANTR Heterogeneous nuclear ribonucleoprotein A1 OS=Pan troglodytes GN=HNRNPA1 PE=2 SV=1 280 436 8.0E-09
sp|P49312|ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus GN=Hnrnpa1 PE=1 SV=2 280 436 8.0E-09
sp|P09867|ROA1_BOVIN Heterogeneous nuclear ribonucleoprotein A1 OS=Bos taurus GN=HNRNPA1 PE=1 SV=2 280 436 8.0E-09
sp|P51968|RO31_XENLA Heterogeneous nuclear ribonucleoprotein A3 homolog 1 OS=Xenopus laevis PE=2 SV=1 280 436 8.0E-09
sp|Q6FKG4|PABP_CANGA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAB1 PE=3 SV=1 281 436 9.0E-09
sp|Q6IP09|PABPB_XENLA Polyadenylate-binding protein 1-B OS=Xenopus laevis GN=pabpc1-b PE=2 SV=1 285 443 9.0E-09
sp|Q5M9F1|RBM34_RAT RNA-binding protein 34 OS=Rattus norvegicus GN=Rbm34 PE=1 SV=1 270 436 9.0E-09
sp|P04256|ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus GN=Hnrnpa1 PE=1 SV=3 280 436 9.0E-09
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 285 436 1.0E-08
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 293 442 1.0E-08
sp|Q5AJS6|MRD1_CANAL Multiple RNA-binding domain-containing protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRD1 PE=3 SV=1 285 445 1.0E-08
sp|P0CB38|PAB4L_HUMAN Polyadenylate-binding protein 4-like OS=Homo sapiens GN=PABPC4L PE=2 SV=1 294 442 2.0E-08
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 249 443 2.0E-08
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 294 442 2.0E-08
sp|A1CRM1|PABP_ASPCL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pab1 PE=3 SV=1 285 443 2.0E-08
sp|Q75A83|MRD1_ASHGO Multiple RNA-binding domain-containing protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRD1 PE=3 SV=2 275 436 2.0E-08
sp|Q28521|ROA1_MACMU Heterogeneous nuclear ribonucleoprotein A1 OS=Macaca mulatta GN=HNRNPA1 PE=2 SV=3 280 436 2.0E-08
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 279 436 2.0E-08
sp|Q6PFR5|TRA2A_MOUSE Transformer-2 protein homolog alpha OS=Mus musculus GN=Tra2a PE=1 SV=1 278 368 2.0E-08
sp|Q13595|TRA2A_HUMAN Transformer-2 protein homolog alpha OS=Homo sapiens GN=TRA2A PE=1 SV=1 278 368 2.0E-08
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 285 442 2.0E-08
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 259 442 3.0E-08
sp|P20965|PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis GN=pabpc1-a PE=1 SV=3 285 443 3.0E-08
sp|P52912|TIA1_MOUSE Nucleolysin TIA-1 OS=Mus musculus GN=Tia1 PE=1 SV=1 276 442 3.0E-08
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 285 442 3.0E-08
sp|Q8CGC6|RBM28_MOUSE RNA-binding protein 28 OS=Mus musculus GN=Rbm28 PE=1 SV=4 281 442 3.0E-08
sp|P31483|TIA1_HUMAN Nucleolysin TIA-1 isoform p40 OS=Homo sapiens GN=TIA1 PE=1 SV=3 276 442 3.0E-08
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 279 436 3.0E-08
sp|Q9M9G6|CTF64_ARATH Cleavage stimulating factor 64 OS=Arabidopsis thaliana GN=CSTF64 PE=1 SV=1 285 359 3.0E-08
sp|Q32P51|RA1L2_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens GN=HNRNPA1L2 PE=2 SV=2 280 436 3.0E-08
sp|Q0U1G2|PABP_PHANO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAB1 PE=3 SV=3 270 436 3.0E-08
sp|Q9SIX3|RBG1_ARATH Probable glycine-rich RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBG1 PE=2 SV=2 286 364 4.0E-08
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 285 365 4.0E-08
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 285 365 4.0E-08
sp|Q09100|RNP24_SCHPO RNA-binding protein rnp24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnp24 PE=3 SV=2 280 373 5.0E-08
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 281 436 5.0E-08
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 255 444 5.0E-08
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 284 368 6.0E-08
sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 265 442 6.0E-08
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 285 444 7.0E-08
sp|P53883|NOP13_YEAST Nucleolar protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP13 PE=1 SV=2 284 363 7.0E-08
sp|Q5ZLN5|TADBP_CHICK TAR DNA-binding protein 43 OS=Gallus gallus GN=TARDBP PE=2 SV=1 285 436 7.0E-08
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 293 425 8.0E-08
sp|Q920Q6|MSI2H_MOUSE RNA-binding protein Musashi homolog 2 OS=Mus musculus GN=Msi2 PE=1 SV=1 285 436 8.0E-08
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 282 436 9.0E-08
sp|Q96DH6|MSI2H_HUMAN RNA-binding protein Musashi homolog 2 OS=Homo sapiens GN=MSI2 PE=1 SV=1 285 436 9.0E-08
sp|Q9LEB4|RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia GN=RBP45 PE=1 SV=1 271 436 1.0E-07
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 276 442 1.0E-07
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 285 436 1.0E-07
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 274 438 1.0E-07
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 283 357 1.0E-07
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 300 436 1.0E-07
sp|F4HT49|PABP1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PAB1 PE=2 SV=2 277 438 1.0E-07
sp|Q5BGA9|MRD1_EMENI Multiple RNA-binding domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mrd1 PE=3 SV=1 250 356 2.0E-07
sp|O13620|MRD1_SCHPO Multiple RNA-binding domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrd1 PE=3 SV=1 196 364 2.0E-07
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 285 357 2.0E-07
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 285 357 2.0E-07
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 285 357 2.0E-07
sp|O80678|UBA2B_ARATH UBP1-associated protein 2B OS=Arabidopsis thaliana GN=UBA2B PE=2 SV=1 285 443 2.0E-07
sp|Q9LQI9|UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana GN=UBP1B PE=1 SV=1 274 436 2.0E-07
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 300 436 2.0E-07
sp|P04147|PABP_YEAST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4 275 442 3.0E-07
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 283 436 3.0E-07
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 272 442 3.0E-07
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 389 434 3.0E-07
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 285 357 3.0E-07
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 285 357 3.0E-07
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 285 365 3.0E-07
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 300 436 3.0E-07
sp|Q2UK72|PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pab1 PE=3 SV=1 285 443 3.0E-07
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 300 436 3.0E-07
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 272 436 4.0E-07
sp|Q13151|ROA0_HUMAN Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens GN=HNRNPA0 PE=1 SV=1 285 350 4.0E-07
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 PE=1 SV=1 285 442 4.0E-07
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 300 436 4.0E-07
sp|Q921F2|TADBP_MOUSE TAR DNA-binding protein 43 OS=Mus musculus GN=Tardbp PE=1 SV=1 285 436 4.0E-07
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 249 375 4.0E-07
sp|Q9CX86|ROA0_MOUSE Heterogeneous nuclear ribonucleoprotein A0 OS=Mus musculus GN=Hnrnpa0 PE=1 SV=1 285 350 5.0E-07
sp|Q93W34|RP45C_ARATH Polyadenylate-binding protein RBP45C OS=Arabidopsis thaliana GN=RBP45C PE=2 SV=1 285 436 5.0E-07
sp|Q02926|RB97D_DROME Ribonucleoprotein RB97D OS=Drosophila melanogaster GN=Rb97D PE=2 SV=1 271 340 5.0E-07
sp|Q22037|ROA1_CAEEL Heterogeneous nuclear ribonucleoprotein A1 OS=Caenorhabditis elegans GN=hrp-1 PE=1 SV=1 280 436 5.0E-07
sp|O13759|CSX1_SCHPO RNA-binding post-transcriptional regulator csx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csx1 PE=1 SV=1 285 436 6.0E-07
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 284 436 7.0E-07
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 300 436 7.0E-07
sp|O60176|YG41_SCHPO Uncharacterized RNA-binding protein C23E6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.01c PE=1 SV=2 284 436 7.0E-07
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 283 439 7.0E-07
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 285 357 8.0E-07
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 300 436 8.0E-07
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 PE=1 SV=1 285 442 8.0E-07
sp|Q8RWN5|RZ1C_ARATH Glycine-rich RNA-binding protein RZ1C OS=Arabidopsis thaliana GN=RZ1C PE=1 SV=1 282 357 8.0E-07
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 283 443 9.0E-07
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 279 436 9.0E-07
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 300 436 9.0E-07
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 283 439 9.0E-07
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 283 439 9.0E-07
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 285 440 1.0E-06
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 285 436 1.0E-06
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 293 442 1.0E-06
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 300 436 1.0E-06
sp|Q9SEE9|SR45_ARATH Serine/arginine-rich splicing factor SR45 OS=Arabidopsis thaliana GN=SR45 PE=1 SV=1 284 358 1.0E-06
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 300 436 1.0E-06
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 300 436 1.0E-06
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 300 436 1.0E-06
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 283 442 2.0E-06
sp|P21187|PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster GN=pAbp PE=1 SV=3 281 442 2.0E-06
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 285 436 2.0E-06
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 284 359 2.0E-06
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 280 442 2.0E-06
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 285 436 2.0E-06
sp|A2Q848|PABP_ASPNC Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pab1 PE=3 SV=1 285 443 2.0E-06
sp|Q9LES2|UBA2A_ARATH UBP1-associated protein 2A OS=Arabidopsis thaliana GN=UBA2A PE=1 SV=1 221 443 2.0E-06
sp|Q4WJT7|MRD1_ASPFU Multiple RNA-binding domain-containing protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrd1 PE=3 SV=1 276 364 3.0E-06
sp|P07909|ROA1_DROME Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster GN=Hrb98DE PE=2 SV=1 285 365 3.0E-06
sp|O04319|PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana GN=PAB6 PE=2 SV=1 236 443 3.0E-06
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 284 359 3.0E-06
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 284 359 3.0E-06
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 284 359 3.0E-06
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 284 359 3.0E-06
sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 285 368 3.0E-06
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 279 436 3.0E-06
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 285 396 3.0E-06
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 259 436 4.0E-06
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 321 442 4.0E-06
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 285 436 4.0E-06
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 284 359 4.0E-06
sp|Q6CSV3|PABP_KLULA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAB1 PE=3 SV=1 285 436 5.0E-06
sp|A5DM21|PABP_PICGU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAB1 PE=3 SV=2 227 396 5.0E-06
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 242 442 5.0E-06
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 247 375 5.0E-06
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 321 442 5.0E-06
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 285 436 5.0E-06
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 285 436 5.0E-06
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 285 436 5.0E-06
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 285 436 5.0E-06
sp|Q9M427|UBP1_NICPL Oligouridylate-binding protein 1 OS=Nicotiana plumbaginifolia GN=UBP1 PE=2 SV=1 279 444 6.0E-06
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 247 375 6.0E-06
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 247 375 6.0E-06
sp|P60050|PABP5_PONPY Polyadenylate-binding protein 5 OS=Pongo pygmaeus GN=PABPC5 PE=3 SV=1 281 436 6.0E-06
sp|P60049|PABP5_PANTR Polyadenylate-binding protein 5 OS=Pan troglodytes GN=PABPC5 PE=3 SV=1 281 436 6.0E-06
sp|P60048|PABP5_HYLLA Polyadenylate-binding protein 5 OS=Hylobates lar GN=PABPC5 PE=3 SV=1 281 436 6.0E-06
sp|Q96DU9|PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens GN=PABPC5 PE=2 SV=1 281 436 6.0E-06
sp|P60047|PABP5_GORGO Polyadenylate-binding protein 5 OS=Gorilla gorilla gorilla GN=PABPC5 PE=3 SV=1 281 436 6.0E-06
sp|Q7JGR2|PABP5_MACMU Polyadenylate-binding protein 5 OS=Macaca mulatta GN=PABPC5 PE=3 SV=1 281 436 6.0E-06
sp|Q4P8R9|PABP_USTMA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAB1 PE=3 SV=1 272 442 6.0E-06
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 272 422 7.0E-06
sp|Q7S6N6|PABP_NEUCR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pabp-1 PE=3 SV=1 281 436 7.0E-06
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 272 422 7.0E-06
sp|P51990|RO22_XENLA Heterogeneous nuclear ribonucleoprotein A2 homolog 2 OS=Xenopus laevis PE=2 SV=1 285 347 8.0E-06
sp|P48810|RB87F_DROME Heterogeneous nuclear ribonucleoprotein 87F OS=Drosophila melanogaster GN=Hrb87F PE=2 SV=2 285 340 8.0E-06
sp|Q6CDH3|PABP_YARLI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1 281 436 9.0E-06
sp|Q503H1|TSAP1_DANRE tRNA selenocysteine 1-associated protein 1 OS=Danio rerio GN=trnau1ap PE=2 SV=1 282 436 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1887 0.8175 0.2724 0.0332 0.0505 0.0148 0.039 0.004 0.0274 0.0002

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3462
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5474
Ophiocordyceps australis map64 (Brazil) OphauB2|2179
Ophiocordyceps camponoti-floridani Ophcf2|07222
Ophiocordyceps camponoti-rufipedis Ophun1|2846
Ophiocordyceps kimflemingae Ophio5|2594
Ophiocordyceps subramaniannii Hirsu2|6598 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6598
MAKSKVKQSKKAPAAEPVSAVKNAGVTKSSKTAKSKSKEIAKSAAKKLVKEKEKPKKKKVVEPESSDESSDESSE
EEADASDSSDSDSASSDVSDSSSDSDSGKAETKKPAAKGKANGKTKAKKAESSDSESDSDSEEEQKPAKKAAAAT
VKAKAKANASKSDSDSDSDSSSESEEEKAAPKAAAKVNGSAKATAAASSDSSDSSGSDADSDEESDDEKPAAKAA
SGDESDEDSEDSDDSEEDSSESKDDADKAATASKKRKAEADIDATPKKAKTENSEAASTLFAGSLSWNVDDATLQ
EAFKDFDGLIGARVVTDKMSGRSRGFGYVDFSDSDAATKAYEAMQGHELDGRALNLDYANARSSDATPQSRAADR
AKKHGDSVSPESDTLFVGNLPFDVDQDTVREFFSAVCETTSVRLPTDPESGNLKGFGYVSFGSIEDAKTCPPAT*
Coding >Hirsu2|6598
ATGGCTAAGTCGAAGGTCAAGCAGAGCAAGAAGGCTCCGGCCGCTGAACCCGTCAGCGCCGTCAAGAATGCGGGC
GTCACCAAGTCGTCGAAGACGGCCAAGTCCAAGTCGAAGGAGATTGCCAAGTCTGCAGCCAAGAAGCTGGTAAAG
GAGAAGGAGAAGCCCAAGAAGAAGAAGGTCGTTGAGCCTGAGTCCTCGGACGAGTCCTCGGACGAGTCCTCTGAG
GAGGAAGCAGACGCTTCCGACTCCTCCGACAGCGACAGCGCCAGCTCCGATGTCTCGGACAGCTCTTCTGATTCC
GACTCTGGGAAGGCGGAGACCAAGAAGCCTGCTGCCAAGGGCAAGGCCAACGGAAAGACCAAGGCCAAGAAGGCC
GAATCCTCTGACTCGGAGTCTGACTCTGACAGCGAGGAGGAGCAAAAGCCTGCCAAGAAGGCGGCCGCCGCCACC
GTTAAAGCCAAGGCAAAGGCGAATGCGTCTAAGTCTGATTCCGACTCCGACTCCGACTCCAGCAGCGAGTCCGAG
GAAGAGAAGGCCGCGCCCAAAGCCGCCGCCAAAGTGAACGGCTCTGCCAAGGCTACTGCTGCCGCCTCGTCGGAC
TCGTCTGACTCGTCGGGCTCGGACGCCGACTCGGACGAGGAGAGCGATGATGAGAAGCCCGCTGCCAAGGCGGCT
TCTGGTGACGAATCTGACGAGGATTCGGAAGACAGCGACGATTCCGAAGAGGATTCCAGCGAGTCCAAGGACGAT
GCTGATAAGGCTGCCACTGCGTCCAAGAAGCGCAAGGCTGAGGCCGACATTGATGCGACGCCCAAGAAGGCCAAG
ACGGAGAACTCGGAGGCTGCCTCTACCCTCTTCGCCGGCAGCCTGAGCTGGAACGTCGACGATGCGACGCTGCAG
GAGGCATTCAAGGACTTTGACGGCCTCATTGGCGCTCGTGTCGTCACTGACAAGATGTCTGGCCGCAGCCGTGGC
TTCGGCTACGTCGACTTCTCGGACTCTGATGCCGCTACCAAGGCTTACGAAGCCATGCAGGGGCACGAGCTCGAC
GGCCGCGCGCTCAACCTTGACTACGCCAACGCACGCTCCTCCGACGCTACACCCCAGAGCCGGGCTGCGGATCGG
GCCAAGAAGCACGGCGACTCTGTCAGCCCTGAGAGCGACACGCTGTTTGTTGGAAACCTGCCCTTTGACGTTGAT
CAAGACACGGTTCGCGAGTTCTTCAGCGCTGTGTGCGAGACGACGAGCGTCCGCCTGCCCACCGACCCCGAGAGC
GGCAATCTGAAAGGCTTCGGCTACGTGAGCTTCGGCTCGATCGAGGATGCCAAGACCTGCCCGCCCGCCACGTGA
Transcript >Hirsu2|6598
ATGGCTAAGTCGAAGGTCAAGCAGAGCAAGAAGGCTCCGGCCGCTGAACCCGTCAGCGCCGTCAAGAATGCGGGC
GTCACCAAGTCGTCGAAGACGGCCAAGTCCAAGTCGAAGGAGATTGCCAAGTCTGCAGCCAAGAAGCTGGTAAAG
GAGAAGGAGAAGCCCAAGAAGAAGAAGGTCGTTGAGCCTGAGTCCTCGGACGAGTCCTCGGACGAGTCCTCTGAG
GAGGAAGCAGACGCTTCCGACTCCTCCGACAGCGACAGCGCCAGCTCCGATGTCTCGGACAGCTCTTCTGATTCC
GACTCTGGGAAGGCGGAGACCAAGAAGCCTGCTGCCAAGGGCAAGGCCAACGGAAAGACCAAGGCCAAGAAGGCC
GAATCCTCTGACTCGGAGTCTGACTCTGACAGCGAGGAGGAGCAAAAGCCTGCCAAGAAGGCGGCCGCCGCCACC
GTTAAAGCCAAGGCAAAGGCGAATGCGTCTAAGTCTGATTCCGACTCCGACTCCGACTCCAGCAGCGAGTCCGAG
GAAGAGAAGGCCGCGCCCAAAGCCGCCGCCAAAGTGAACGGCTCTGCCAAGGCTACTGCTGCCGCCTCGTCGGAC
TCGTCTGACTCGTCGGGCTCGGACGCCGACTCGGACGAGGAGAGCGATGATGAGAAGCCCGCTGCCAAGGCGGCT
TCTGGTGACGAATCTGACGAGGATTCGGAAGACAGCGACGATTCCGAAGAGGATTCCAGCGAGTCCAAGGACGAT
GCTGATAAGGCTGCCACTGCGTCCAAGAAGCGCAAGGCTGAGGCCGACATTGATGCGACGCCCAAGAAGGCCAAG
ACGGAGAACTCGGAGGCTGCCTCTACCCTCTTCGCCGGCAGCCTGAGCTGGAACGTCGACGATGCGACGCTGCAG
GAGGCATTCAAGGACTTTGACGGCCTCATTGGCGCTCGTGTCGTCACTGACAAGATGTCTGGCCGCAGCCGTGGC
TTCGGCTACGTCGACTTCTCGGACTCTGATGCCGCTACCAAGGCTTACGAAGCCATGCAGGGGCACGAGCTCGAC
GGCCGCGCGCTCAACCTTGACTACGCCAACGCACGCTCCTCCGACGCTACACCCCAGAGCCGGGCTGCGGATCGG
GCCAAGAAGCACGGCGACTCTGTCAGCCCTGAGAGCGACACGCTGTTTGTTGGAAACCTGCCCTTTGACGTTGAT
CAAGACACGGTTCGCGAGTTCTTCAGCGCTGTGTGCGAGACGACGAGCGTCCGCCTGCCCACCGACCCCGAGAGC
GGCAATCTGAAAGGCTTCGGCTACGTGAGCTTCGGCTCGATCGAGGATGCCAAGACCTGCCCGCCCGCCACGTGA
Gene >Hirsu2|6598
ATGGCTAAGTCGAAGGTCAAGCAGAGCAAGAAGGCTCCGGCCGCTGAACCCGTCAGCGCCGTCAAGAATGCGGGC
GTCACCAAGTCGTCGAAGACGGCCAAGTCCAAGTCGAAGGAGATTGCCAAGTCTGCAGCCAAGAAGCTGGTAAAG
GAGAAGGAGAAGCCCAAGAAGAAGAAGGTCGTTGAGCCTGAGTCCTCGGACGAGTCCTCGGACGAGTCCTCTGAG
GAGGAAGCAGACGCTTCCGACTCCTCCGACAGCGACAGCGCCAGCTCCGATGTCTCGGACAGCTCTTCTGATTCC
GACTCTGGGAAGGCGGAGACCAAGAAGCCTGCTGCCAAGGGCAAGGCCAACGGAAAGACCAAGGCCAAGAAGGCC
GAATCCTCTGACTCGGAGTCTGACTCTGACAGCGAGGAGGAGCAAAAGCCTGCCAAGAAGGCGGCCGCCGCCACC
GTTAAAGCCAAGGCAAAGGCGAATGCGTCTAAGTCTGATTCCGACTCCGACTCCGACTCCAGCAGCGAGTCCGAG
GAAGAGAAGGCCGCGCCCAAAGCCGCCGCCAAAGTGAACGGCTCTGCCAAGGCTACTGCTGCCGCCTCGTCGGAC
TCGTCTGACTCGTCGGGCTCGGACGCCGACTCGGACGAGGAGAGCGATGATGAGAAGCCCGCTGCCAAGGTTTGT
CGCTCTGATGCCCTTTTTGATCTGGTCGATGCTAACACTGTCCTACCAAGGCGGCTTCTGGTGACGAATCTGACG
AGGATTCGGAAGACAGCGACGATTCCGAAGAGGATTCCAGCGAGTCCAAGGACGATGCTGATAAGGCTGCCACTG
CGTCCAAGAAGCGCAAGGCTGAGGCCGACATTGATGCGACGCCCAAGAAGGCCAAGACGGAGAACTCGGAGGCTG
CCTCTACCCTCTTCGCCGGCAGCCTGAGCTGGAACGTCGACGATGCGACGCTGCAGGAGGCATTCAAGGACTTTG
ACGGCCTCATTGGCGCTCGTGTCGTCACTGACAAGATGTCTGGCCGCAGCCGTGGCTTCGGCTACGTCGACTTCT
CGGACTCTGATGCCGCTACCAAGGCTTACGAAGCCATGCAGGGGCACGAGCTCGACGGCCGCGCGCTCAACCTTG
ACTACGCCAACGCACGCTCCTCCGACGCTACACCCCAGAGCCGGGCTGCGGATCGGGCCAAGAAGCACGGCGACT
CTGTCAGCCCTGAGAGCGACACGCTGTTTGTTGGAAACCTGCCCTTTGACGTTGATCAAGACACGGTTCGCGAGT
TCTTCAGCGCTGTGTGCGAGACGACGAGCGTCCGCCTGCCCACCGACCCGTAAGCACCCCCATCGATGCTTATCA
ATGTCCTCGGCTCGAATACTGACACGCCTCACAGCGAGAGCGGCAATCTGAAAGGCTTCGGCTACGTGAGCTTCG
GCTCGATCGAGGATGCCAAGACCGTCTTCCAGGAGCTCAACGGTGCCTCGATCGGCGCCGGTCGCTCGACCCGCA
ATGTTCGCCTCGACTTTGCCAGTGCCCGCCCGCCACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail