Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6597
Gene name
LocationContig_342:21398..22058
Strand+
Gene length (bp)660
Transcript length (bp)453
Coding sequence length (bp)453
Protein length (aa) 151

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00411 Ribosomal_S11 Ribosomal protein S11 2.8E-46 28 146

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19115|RS14_NEUCR 40S ribosomal protein S14 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rps-14 PE=3 SV=2 3 139 7.0E-84
sp|P46295|RS14_CHLRE 40S ribosomal protein S14 OS=Chlamydomonas reinhardtii GN=RPS14 PE=3 SV=1 4 139 1.0E-80
sp|P19950|RS141_MAIZE 40S ribosomal protein S14 OS=Zea mays PE=3 SV=1 5 139 2.0E-78
sp|P19951|RS142_MAIZE 40S ribosomal protein S14 OS=Zea mays PE=3 SV=1 5 139 7.0E-78
sp|Q54EG3|RS14_DICDI 40S ribosomal protein S14 OS=Dictyostelium discoideum GN=rps14 PE=3 SV=1 4 150 1.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19115|RS14_NEUCR 40S ribosomal protein S14 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rps-14 PE=3 SV=2 3 139 7.0E-84
sp|P46295|RS14_CHLRE 40S ribosomal protein S14 OS=Chlamydomonas reinhardtii GN=RPS14 PE=3 SV=1 4 139 1.0E-80
sp|P19950|RS141_MAIZE 40S ribosomal protein S14 OS=Zea mays PE=3 SV=1 5 139 2.0E-78
sp|P19951|RS142_MAIZE 40S ribosomal protein S14 OS=Zea mays PE=3 SV=1 5 139 7.0E-78
sp|Q54EG3|RS14_DICDI 40S ribosomal protein S14 OS=Dictyostelium discoideum GN=rps14 PE=3 SV=1 4 150 1.0E-77
sp|Q08699|RS14_PODCA 40S ribosomal protein S14 OS=Podocoryna carnea GN=RPS14 PE=2 SV=1 4 139 1.0E-77
sp|P42036|RS143_ARATH 40S ribosomal protein S14-3 OS=Arabidopsis thaliana GN=RPS14C PE=2 SV=2 5 139 4.0E-77
sp|Q9CAX6|RS142_ARATH 40S ribosomal protein S14-2 OS=Arabidopsis thaliana GN=RPS14B PE=1 SV=1 5 139 4.0E-77
sp|Q7QBX2|RS14B_ANOGA 40S ribosomal protein S14b OS=Anopheles gambiae GN=RpS14b PE=3 SV=2 6 139 4.0E-77
sp|Q7QEH1|RS14A_ANOGA 40S ribosomal protein S14a OS=Anopheles gambiae GN=RpS14a PE=3 SV=2 1 139 8.0E-77
sp|O22584|RS14_LUPLU 40S ribosomal protein S14 OS=Lupinus luteus GN=RPS14 PE=2 SV=1 11 139 8.0E-77
sp|P48150|RS14_CAEEL 40S ribosomal protein S14 OS=Caenorhabditis elegans GN=rps-14 PE=3 SV=1 1 139 9.0E-77
sp|P14130|RS14_DROME 40S ribosomal protein S14 OS=Drosophila melanogaster GN=RpS14a PE=1 SV=1 4 139 1.0E-76
sp|Q6XI08|RS14A_DROYA 40S ribosomal protein S14a OS=Drosophila yakuba GN=RpS14a PE=2 SV=1 4 139 1.0E-76
sp|P62264|RS14_MOUSE 40S ribosomal protein S14 OS=Mus musculus GN=Rps14 PE=1 SV=3 4 139 5.0E-76
sp|P62263|RS14_HUMAN 40S ribosomal protein S14 OS=Homo sapiens GN=RPS14 PE=1 SV=3 4 139 5.0E-76
sp|P62265|RS14_CRIGR 40S ribosomal protein S14 OS=Cricetulus griseus GN=RPS14 PE=2 SV=3 4 139 5.0E-76
sp|Q9SIH0|RS141_ARATH 40S ribosomal protein S14-1 OS=Arabidopsis thaliana GN=RPS14A PE=1 SV=1 5 139 5.0E-76
sp|P13471|RS14_RAT 40S ribosomal protein S14 OS=Rattus norvegicus GN=Rps14 PE=2 SV=3 4 139 9.0E-76
sp|Q1HR24|RS14_AEDAE 40S ribosomal protein S14 OS=Aedes aegypti GN=RpS14 PE=2 SV=1 4 139 1.0E-75
sp|Q5UAM9|RS14_BOMMO 40S ribosomal protein S14 OS=Bombyx mori GN=RpS14 PE=2 SV=1 2 139 6.0E-74
sp|P48855|RS14_PROCL 40S ribosomal protein S14 OS=Procambarus clarkii GN=RPS14 PE=2 SV=1 1 139 7.0E-74
sp|P27069|RS14_KLULA 40S ribosomal protein S14 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPS14 PE=1 SV=1 21 139 1.0E-68
sp|P06367|RS14A_YEAST 40S ribosomal protein S14-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS14A PE=1 SV=5 21 139 1.0E-68
sp|P39516|RS14B_YEAST 40S ribosomal protein S14-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS14B PE=1 SV=2 21 139 2.0E-68
sp|Q96W53|RS14_CANAX 40S ribosomal protein S14 OS=Candida albicans GN=RPS14 PE=3 SV=1 26 139 3.0E-68
sp|Q9XEK6|RS14_TORRU 40S ribosomal protein S14 OS=Tortula ruralis GN=RPS14 PE=2 SV=1 26 139 2.0E-63
sp|P19800|RS14_TRYBB 40S ribosomal protein S14 OS=Trypanosoma brucei brucei GN=RPS14 PE=3 SV=1 11 139 2.0E-60
sp|P0CT57|RS14B_SCHPO 40S ribosomal protein S14-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1402 PE=3 SV=1 15 139 8.0E-56
sp|P0CT56|RS14A_SCHPO 40S ribosomal protein S14-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1401 PE=3 SV=1 15 139 8.0E-56
sp|A0B9L3|RS11_METTP 30S ribosomal protein S11 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps11 PE=3 SV=1 27 150 2.0E-49
sp|Q0W1V4|RS11_METAR 30S ribosomal protein S11 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps11 PE=3 SV=1 24 150 4.0E-49
sp|A6UW04|RS11_META3 30S ribosomal protein S11 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps11 PE=3 SV=1 27 146 1.0E-46
sp|A7IAH6|RS11_METB6 30S ribosomal protein S11 OS=Methanoregula boonei (strain 6A8) GN=rps11 PE=3 SV=1 27 142 2.0E-46
sp|Q8TRR0|RS11_METAC 30S ribosomal protein S11 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps11 PE=3 SV=1 24 146 6.0E-46
sp|Q8PV17|RS11_METMA 30S ribosomal protein S11 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps11 PE=3 SV=1 24 146 2.0E-45
sp|Q9YB55|RS11_AERPE 30S ribosomal protein S11 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps11 PE=3 SV=2 24 139 3.0E-45
sp|C6A1B2|RS11_THESM 30S ribosomal protein S11 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rps11 PE=3 SV=1 27 142 4.0E-45
sp|Q12ZR4|RS11_METBU 30S ribosomal protein S11 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps11 PE=3 SV=1 26 146 6.0E-45
sp|Q2FT98|RS11_METHJ 30S ribosomal protein S11 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps11 PE=3 SV=1 22 142 7.0E-45
sp|Q46GC9|RS11_METBF 30S ribosomal protein S11 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps11 PE=3 SV=1 24 146 1.0E-44
sp|Q18G55|RS11_HALWD 30S ribosomal protein S11 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps11 PE=3 SV=1 27 140 2.0E-44
sp|Q2NFZ5|RS11_METST 30S ribosomal protein S11 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps11 PE=3 SV=1 27 137 2.0E-44
sp|A3CWH8|RS11_METMJ 30S ribosomal protein S11 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps11 PE=3 SV=1 24 138 3.0E-44
sp|Q6LXM9|RS11_METMP 30S ribosomal protein S11 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps11 PE=3 SV=1 27 139 3.0E-44
sp|A6VGQ8|RS11_METM7 30S ribosomal protein S11 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps11 PE=3 SV=1 27 139 3.0E-44
sp|A4FWL3|RS11_METM5 30S ribosomal protein S11 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps11 PE=3 SV=1 27 139 3.0E-44
sp|A2SSV8|RS11_METLZ 30S ribosomal protein S11 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps11 PE=3 SV=1 27 142 6.0E-44
sp|A6UPW6|RS11_METVS 30S ribosomal protein S11 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps11 PE=3 SV=1 27 139 1.0E-43
sp|P54021|RS11_METJA 30S ribosomal protein S11 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps11 PE=3 SV=1 27 139 3.0E-43
sp|Q5JJF3|RS11_THEKO 30S ribosomal protein S11 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps11 PE=3 SV=1 27 142 6.0E-43
sp|B6YSQ2|RS11_THEON 30S ribosomal protein S11 OS=Thermococcus onnurineus (strain NA1) GN=rps11 PE=3 SV=1 27 142 7.0E-43
sp|A2BK78|RS11_HYPBU 30S ribosomal protein S11 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps11 PE=3 SV=1 24 139 1.0E-42
sp|A3DMQ5|RS11_STAMF 30S ribosomal protein S11 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps11 PE=3 SV=1 24 139 2.0E-42
sp|Q8U0E3|RS11_PYRFU 30S ribosomal protein S11 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps11 PE=1 SV=1 27 142 2.0E-42
sp|Q3IQT7|RS11_NATPD 30S ribosomal protein S11 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps11 PE=3 SV=1 24 140 4.0E-42
sp|P62011|RS11_PYRHO 30S ribosomal protein S11 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps11 PE=3 SV=1 27 142 5.0E-42
sp|P62010|RS11_PYRAB 30S ribosomal protein S11 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps11 PE=1 SV=1 27 142 5.0E-42
sp|C5A250|RS11_THEGJ 30S ribosomal protein S11 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rps11 PE=3 SV=1 27 142 1.0E-41
sp|A8A8W4|RS11_IGNH4 30S ribosomal protein S11 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps11 PE=3 SV=1 24 138 3.0E-41
sp|Q8TVB9|RS11_METKA 30S ribosomal protein S11 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps11 PE=3 SV=1 27 137 3.0E-41
sp|O28001|RS11_ARCFU 30S ribosomal protein S11 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps11 PE=3 SV=1 27 150 6.0E-41
sp|Q97B94|RS11_THEVO 30S ribosomal protein S11 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps11 PE=3 SV=2 28 139 4.0E-40
sp|Q8SSA6|RS14_ENCCU 40S ribosomal protein S14 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS14 PE=1 SV=1 29 137 4.0E-40
sp|Q9HJD8|RS11_THEAC 30S ribosomal protein S11 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps11 PE=3 SV=1 28 139 4.0E-40
sp|A3MX63|RS11_PYRCJ 30S ribosomal protein S11 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps11 PE=3 SV=1 24 150 5.0E-40
sp|A1RRY6|RS11_PYRIL 30S ribosomal protein S11 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps11 PE=3 SV=1 24 150 6.0E-40
sp|Q9HQJ5|RS11_HALSA 30S ribosomal protein S11 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps11 PE=3 SV=2 27 140 2.0E-39
sp|Q96YV9|RS11_SULTO 30S ribosomal protein S11 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps11 PE=3 SV=2 24 138 3.0E-39
sp|P95988|RS11_SULSO 30S ribosomal protein S11 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps11 PE=3 SV=2 24 138 3.0E-39
sp|A4WLE0|RS11_PYRAR 30S ribosomal protein S11 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps11 PE=3 SV=1 24 150 1.0E-38
sp|Q8ZTM9|RS11_PYRAE 30S ribosomal protein S11 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps11 PE=3 SV=1 24 150 1.0E-38
sp|P10788|RS11_HALMA 30S ribosomal protein S11 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps11 PE=1 SV=3 24 140 2.0E-38
sp|A0RWI9|RS11_CENSY 30S ribosomal protein S11 OS=Cenarchaeum symbiosum (strain A) GN=rps11 PE=3 SV=2 27 139 2.0E-38
sp|Q6KZP6|RS11_PICTO 30S ribosomal protein S11 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps11 PE=3 SV=1 28 139 6.0E-37
sp|A5UN54|RS11_METS3 30S ribosomal protein S11 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps11 PE=3 SV=1 27 137 1.0E-36
sp|A1RWT7|RS11_THEPD 30S ribosomal protein S11 OS=Thermofilum pendens (strain Hrk 5) GN=rps11 PE=3 SV=1 27 141 1.0E-35
sp|A8M9Z7|RS11_CALMQ 30S ribosomal protein S11 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rps11 PE=3 SV=1 24 138 1.0E-35
sp|O26143|RS11_METTH 30S ribosomal protein S11 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps11 PE=3 SV=1 27 137 5.0E-35
sp|P39469|RS11_SULAC 30S ribosomal protein S11 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps11 PE=3 SV=2 24 138 3.0E-32
sp|Q74N73|RS11_NANEQ 30S ribosomal protein S11 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps11 PE=3 SV=1 27 137 2.0E-31
sp|A4YIN3|RS11_METS5 30S ribosomal protein S11 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps11 PE=3 SV=1 24 138 2.0E-31
sp|B1L796|RS11_KORCO 30S ribosomal protein S11 OS=Korarchaeum cryptofilum (strain OPF8) GN=rps11 PE=3 SV=1 27 137 7.0E-30
sp|Q29303|RS14_PIG 40S ribosomal protein S14 (Fragment) OS=Sus scrofa GN=RPS14 PE=2 SV=1 4 80 9.0E-29
sp|P93377|RS14_TOBAC 40S ribosomal protein S14 (Fragment) OS=Nicotiana tabacum GN=RPS14 PE=2 SV=1 85 139 2.0E-27
sp|Q057C7|RS11_BUCCC 30S ribosomal protein S11 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpsK PE=3 SV=1 5 146 7.0E-19
sp|Q2YAX4|RS11_NITMU 30S ribosomal protein S11 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpsK PE=3 SV=1 28 140 9.0E-19
sp|B0T2E5|RS11_CAUSK 30S ribosomal protein S11 OS=Caulobacter sp. (strain K31) GN=rpsK PE=3 SV=1 24 140 1.0E-18
sp|P59380|RS11_WIGBR 30S ribosomal protein S11 OS=Wigglesworthia glossinidia brevipalpis GN=rpsK PE=3 SV=1 11 140 1.0E-18
sp|B8F6P8|RS11_HAEPS 30S ribosomal protein S11 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rpsK PE=3 SV=1 24 146 1.0E-18
sp|A6VLL1|RS11_ACTSZ 30S ribosomal protein S11 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpsK PE=3 SV=1 24 146 2.0E-18
sp|Q65QX8|RS11_MANSM 30S ribosomal protein S11 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsK PE=3 SV=1 24 146 2.0E-18
sp|B1Y8B3|RS11_LEPCP 30S ribosomal protein S11 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpsK PE=3 SV=1 28 146 3.0E-18
sp|Q9CL52|RS11_PASMU 30S ribosomal protein S11 OS=Pasteurella multocida (strain Pm70) GN=rpsK PE=3 SV=1 24 146 3.0E-18
sp|B0UX37|RS11_HISS2 30S ribosomal protein S11 OS=Histophilus somni (strain 2336) GN=rpsK PE=3 SV=1 24 146 3.0E-18
sp|Q9A8T0|RS11_CAUCR 30S ribosomal protein S11 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsK PE=3 SV=1 24 140 3.0E-18
sp|B8H4F7|RS11_CAUCN 30S ribosomal protein S11 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpsK PE=3 SV=1 24 140 3.0E-18
sp|Q0I139|RS11_HAES1 30S ribosomal protein S11 OS=Haemophilus somnus (strain 129Pt) GN=rpsK PE=3 SV=1 24 146 3.0E-18
sp|Q1LI61|RS11_CUPMC 30S ribosomal protein S11 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rpsK PE=3 SV=1 28 140 3.0E-18
sp|A5UDS4|RS11_HAEIE 30S ribosomal protein S11 OS=Haemophilus influenzae (strain PittEE) GN=rpsK PE=3 SV=1 24 146 3.0E-18
sp|Q4QM99|RS11_HAEI8 30S ribosomal protein S11 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsK PE=3 SV=1 24 146 3.0E-18
sp|B2UEJ5|RS11_RALPJ 30S ribosomal protein S11 OS=Ralstonia pickettii (strain 12J) GN=rpsK PE=3 SV=1 28 140 3.0E-18
sp|Q8XV36|RS11_RALSO 30S ribosomal protein S11 OS=Ralstonia solanacearum (strain GMI1000) GN=rpsK PE=3 SV=1 28 140 4.0E-18
sp|B3R7E5|RS11_CUPTR 30S ribosomal protein S11 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsK PE=3 SV=1 28 140 4.0E-18
sp|Q46WG7|RS11_CUPPJ 30S ribosomal protein S11 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsK PE=3 SV=1 28 140 4.0E-18
sp|Q0K643|RS11_CUPNH 30S ribosomal protein S11 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsK PE=3 SV=1 28 140 4.0E-18
sp|B3PK60|RS11_CELJU 30S ribosomal protein S11 OS=Cellvibrio japonicus (strain Ueda107) GN=rpsK PE=3 SV=1 28 146 5.0E-18
sp|B8GV35|RS11_THISH 30S ribosomal protein S11 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rpsK PE=3 SV=1 28 146 5.0E-18
sp|A4SUY4|RS11_POLSQ 30S ribosomal protein S11 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rpsK PE=3 SV=1 28 140 5.0E-18
sp|Q0VSI0|RS11_ALCBS 30S ribosomal protein S11 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpsK PE=3 SV=1 28 140 6.0E-18
sp|Q7VKF6|RS11_HAEDU 30S ribosomal protein S11 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsK PE=3 SV=1 24 146 6.0E-18
sp|B0BSV4|RS11_ACTPJ 30S ribosomal protein S11 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpsK PE=3 SV=1 24 146 6.0E-18
sp|B3GZ34|RS11_ACTP7 30S ribosomal protein S11 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpsK PE=3 SV=1 24 146 6.0E-18
sp|A3N380|RS11_ACTP2 30S ribosomal protein S11 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsK PE=3 SV=1 24 146 6.0E-18
sp|Q0ANS3|RS11_MARMM 30S ribosomal protein S11 OS=Maricaulis maris (strain MCS10) GN=rpsK PE=3 SV=1 24 140 8.0E-18
sp|B0UHU6|RS11_METS4 30S ribosomal protein S11 OS=Methylobacterium sp. (strain 4-46) GN=rpsK PE=3 SV=1 25 146 9.0E-18
sp|B8IT34|RS11_METNO 30S ribosomal protein S11 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsK PE=3 SV=1 25 146 9.0E-18
sp|Q0AIH3|RS11_NITEC 30S ribosomal protein S11 OS=Nitrosomonas eutropha (strain C91) GN=rpsK PE=3 SV=1 24 146 1.0E-17
sp|B8EIT4|RS11_METSB 30S ribosomal protein S11 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsK PE=3 SV=1 25 146 1.0E-17
sp|Q2W2L2|RS11_MAGSA 30S ribosomal protein S11 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpsK PE=3 SV=1 24 146 1.0E-17
sp|Q3SLM6|RS11_THIDA 30S ribosomal protein S11 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpsK PE=3 SV=1 28 146 1.0E-17
sp|B4F1K7|RS11_PROMH 30S ribosomal protein S11 OS=Proteus mirabilis (strain HI4320) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|Q7MYH3|RS11_PHOLL 30S ribosomal protein S11 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|C6DFS5|RS11_PECCP 30S ribosomal protein S11 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|Q6CZZ3|RS11_PECAS 30S ribosomal protein S11 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|A6TEV0|RS11_KLEP7 30S ribosomal protein S11 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B1JJG8|RS11_YERPY 30S ribosomal protein S11 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|Q664U4|RS11_YERPS 30S ribosomal protein S11 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|A4TH13|RS11_YERPP 30S ribosomal protein S11 OS=Yersinia pestis (strain Pestoides F) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|Q1CCW6|RS11_YERPN 30S ribosomal protein S11 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|A9R916|RS11_YERPG 30S ribosomal protein S11 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|Q8ZJ89|RS11_YERPE 30S ribosomal protein S11 OS=Yersinia pestis GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B2K514|RS11_YERPB 30S ribosomal protein S11 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|Q1C2W9|RS11_YERPA 30S ribosomal protein S11 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|A7FNL2|RS11_YERP3 30S ribosomal protein S11 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|A5V5X6|RS11_SPHWW 30S ribosomal protein S11 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpsK PE=3 SV=1 25 140 2.0E-17
sp|A4WFA5|RS11_ENT38 30S ribosomal protein S11 OS=Enterobacter sp. (strain 638) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|Q98N34|RS11_RHILO 30S ribosomal protein S11 OS=Rhizobium loti (strain MAFF303099) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|Q8Z1X5|RS11_SALTI 30S ribosomal protein S11 OS=Salmonella typhi GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|P44379|RS11_HAEIN 30S ribosomal protein S11 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsK PE=3 SV=2 24 146 2.0E-17
sp|Q3YWW2|RS11_SHISS 30S ribosomal protein S11 OS=Shigella sonnei (strain Ss046) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|P0A7S2|RS11_SHIFL 30S ribosomal protein S11 OS=Shigella flexneri GN=rpsK PE=3 SV=2 28 146 2.0E-17
sp|Q0T005|RS11_SHIF8 30S ribosomal protein S11 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|Q32B54|RS11_SHIDS 30S ribosomal protein S11 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|Q31VX9|RS11_SHIBS 30S ribosomal protein S11 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B2U2R6|RS11_SHIB3 30S ribosomal protein S11 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|A9MN70|RS11_SALAR 30S ribosomal protein S11 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|Q82X71|RS11_NITEU 30S ribosomal protein S11 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpsK PE=3 SV=1 24 146 2.0E-17
sp|B7LRR4|RS11_ESCF3 30S ribosomal protein S11 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|Q1R635|RS11_ECOUT 30S ribosomal protein S11 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B1LHB1|RS11_ECOSM 30S ribosomal protein S11 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B6I211|RS11_ECOSE 30S ribosomal protein S11 OS=Escherichia coli (strain SE11) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B7NDR9|RS11_ECOLU 30S ribosomal protein S11 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|P0A7R9|RS11_ECOLI 30S ribosomal protein S11 OS=Escherichia coli (strain K12) GN=rpsK PE=1 SV=2 28 146 2.0E-17
sp|B1IQ02|RS11_ECOLC 30S ribosomal protein S11 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|P0A7S0|RS11_ECOL6 30S ribosomal protein S11 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsK PE=3 SV=2 28 146 2.0E-17
sp|Q0TCG4|RS11_ECOL5 30S ribosomal protein S11 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|A1AGI8|RS11_ECOK1 30S ribosomal protein S11 OS=Escherichia coli O1:K1 / APEC GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|A8A5A2|RS11_ECOHS 30S ribosomal protein S11 OS=Escherichia coli O9:H4 (strain HS) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B1X6E9|RS11_ECODH 30S ribosomal protein S11 OS=Escherichia coli (strain K12 / DH10B) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|C4ZUF2|RS11_ECOBW 30S ribosomal protein S11 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B7M103|RS11_ECO8A 30S ribosomal protein S11 OS=Escherichia coli O8 (strain IAI1) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B7N182|RS11_ECO81 30S ribosomal protein S11 OS=Escherichia coli O81 (strain ED1a) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B7NLL7|RS11_ECO7I 30S ribosomal protein S11 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B5YT16|RS11_ECO5E 30S ribosomal protein S11 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|P0A7S1|RS11_ECO57 30S ribosomal protein S11 OS=Escherichia coli O157:H7 GN=rpsK PE=3 SV=2 28 146 2.0E-17
sp|B7LHZ9|RS11_ECO55 30S ribosomal protein S11 OS=Escherichia coli (strain 55989 / EAEC) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B7MCR3|RS11_ECO45 30S ribosomal protein S11 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B7UK21|RS11_ECO27 30S ribosomal protein S11 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|A7ZSI6|RS11_ECO24 30S ribosomal protein S11 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B2IF94|RS11_BEII9 30S ribosomal protein S11 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsK PE=3 SV=1 25 146 2.0E-17
sp|O54296|RS11_SALTY 30S ribosomal protein S11 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsK PE=3 SV=2 28 146 2.0E-17
sp|B4TXC0|RS11_SALSV 30S ribosomal protein S11 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|C0PZW0|RS11_SALPC 30S ribosomal protein S11 OS=Salmonella paratyphi C (strain RKS4594) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|A9N8C1|RS11_SALPB 30S ribosomal protein S11 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|Q5PK08|RS11_SALPA 30S ribosomal protein S11 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B4SUR8|RS11_SALNS 30S ribosomal protein S11 OS=Salmonella newport (strain SL254) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B4TJY7|RS11_SALHS 30S ribosomal protein S11 OS=Salmonella heidelberg (strain SL476) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B5RH38|RS11_SALG2 30S ribosomal protein S11 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B5FJJ2|RS11_SALDC 30S ribosomal protein S11 OS=Salmonella dublin (strain CT_02021853) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|Q57J54|RS11_SALCH 30S ribosomal protein S11 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B5F7S3|RS11_SALA4 30S ribosomal protein S11 OS=Salmonella agona (strain SL483) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|Q2NQP5|RS11_SODGM 30S ribosomal protein S11 OS=Sodalis glossinidius (strain morsitans) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|B7J266|RS11_BORBZ 30S ribosomal protein S11 OS=Borrelia burgdorferi (strain ZS7) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|O51454|RS11_BORBU 30S ribosomal protein S11 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpsK PE=3 SV=2 28 146 2.0E-17
sp|Q661B9|RS11_BORBP 30S ribosomal protein S11 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|Q0SN06|RS11_BORAP 30S ribosomal protein S11 OS=Borrelia afzelii (strain PKo) GN=rpsK PE=3 SV=1 28 146 2.0E-17
sp|A1JS03|RS11_YERE8 30S ribosomal protein S11 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsK PE=3 SV=1 28 146 3.0E-17
sp|Q5NQ41|RS11_ZYMMO 30S ribosomal protein S11 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpsK PE=3 SV=1 28 140 3.0E-17
sp|B4R8P0|RS11_PHEZH 30S ribosomal protein S11 OS=Phenylobacterium zucineum (strain HLK1) GN=rpsK PE=3 SV=1 24 140 3.0E-17
sp|Q7NQH5|RS11_CHRVO 30S ribosomal protein S11 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpsK PE=3 SV=1 28 146 3.0E-17
sp|B8D826|RS11_BUCAT 30S ribosomal protein S11 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rpsK PE=3 SV=1 24 146 3.0E-17
sp|P57568|RS11_BUCAI 30S ribosomal protein S11 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpsK PE=3 SV=1 24 146 3.0E-17
sp|B8D9S4|RS11_BUCA5 30S ribosomal protein S11 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rpsK PE=3 SV=1 24 146 3.0E-17
sp|Q8K972|RS11_BUCAP 30S ribosomal protein S11 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpsK PE=3 SV=1 24 146 3.0E-17
sp|Q2RQY3|RS11_RHORT 30S ribosomal protein S11 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsK PE=3 SV=1 25 146 3.0E-17
sp|B4RT51|RS11_ALTMD 30S ribosomal protein S11 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rpsK PE=3 SV=1 24 146 4.0E-17
sp|B1JAI9|RS11_PSEPW 30S ribosomal protein S11 OS=Pseudomonas putida (strain W619) GN=rpsK PE=3 SV=1 25 146 4.0E-17
sp|P59374|RS11_PSEPK 30S ribosomal protein S11 OS=Pseudomonas putida (strain KT2440) GN=rpsK PE=3 SV=1 25 146 4.0E-17
sp|A5VXS0|RS11_PSEP1 30S ribosomal protein S11 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsK PE=3 SV=1 25 146 4.0E-17
sp|Q1IFU3|RS11_PSEE4 30S ribosomal protein S11 OS=Pseudomonas entomophila (strain L48) GN=rpsK PE=3 SV=1 25 146 4.0E-17
sp|B0KK89|RS11_PSEPG 30S ribosomal protein S11 OS=Pseudomonas putida (strain GB-1) GN=rpsK PE=3 SV=1 25 146 4.0E-17
sp|A8GKH5|RS11_SERP5 30S ribosomal protein S11 OS=Serratia proteamaculans (strain 568) GN=rpsK PE=3 SV=1 28 146 4.0E-17
sp|C5BQ84|RS11_TERTT 30S ribosomal protein S11 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpsK PE=3 SV=1 28 146 4.0E-17
sp|B1XSS5|RS11_POLNS 30S ribosomal protein S11 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rpsK PE=3 SV=1 28 140 5.0E-17
sp|A6U882|RS11_SINMW 30S ribosomal protein S11 OS=Sinorhizobium medicae (strain WSM419) GN=rpsK PE=3 SV=1 25 146 5.0E-17
sp|C3MB02|RS11_RHISN 30S ribosomal protein S11 OS=Rhizobium sp. (strain NGR234) GN=rpsK PE=3 SV=1 25 146 5.0E-17
sp|Q925W7|RS11_RHIME 30S ribosomal protein S11 OS=Rhizobium meliloti (strain 1021) GN=rpsK PE=3 SV=1 25 146 5.0E-17
sp|Q5FU06|RS11_GLUOX 30S ribosomal protein S11 OS=Gluconobacter oxydans (strain 621H) GN=rpsK PE=3 SV=1 18 146 6.0E-17
sp|A4VHQ3|RS11_PSEU5 30S ribosomal protein S11 OS=Pseudomonas stutzeri (strain A1501) GN=rpsK PE=3 SV=1 25 146 6.0E-17
sp|Q7VTA7|RS11_BORPE 30S ribosomal protein S11 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rpsK PE=3 SV=1 28 140 6.0E-17
sp|Q7W2D1|RS11_BORPA 30S ribosomal protein S11 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rpsK PE=3 SV=1 28 140 6.0E-17
sp|Q7WR99|RS11_BORBR 30S ribosomal protein S11 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rpsK PE=3 SV=1 28 140 6.0E-17
sp|Q2L245|RS11_BORA1 30S ribosomal protein S11 OS=Bordetella avium (strain 197N) GN=rpsK PE=3 SV=1 28 140 6.0E-17
sp|Q13TJ4|RS11_BURXL 30S ribosomal protein S11 OS=Burkholderia xenovorans (strain LB400) GN=rpsK PE=3 SV=1 28 140 6.0E-17
sp|A2SLD3|RS11_METPP 30S ribosomal protein S11 OS=Methylibium petroleiphilum (strain PM1) GN=rpsK PE=3 SV=1 28 146 6.0E-17
sp|Q488Z0|RS11_COLP3 30S ribosomal protein S11 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsK PE=3 SV=1 24 146 6.0E-17
sp|Q493I6|RS11_BLOPB 30S ribosomal protein S11 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpsK PE=3 SV=1 24 146 7.0E-17
sp|A4XZ67|RS11_PSEMY 30S ribosomal protein S11 OS=Pseudomonas mendocina (strain ymp) GN=rpsK PE=3 SV=1 25 146 7.0E-17
sp|Q9HWF8|RS11_PSEAE 30S ribosomal protein S11 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsK PE=3 SV=1 25 146 7.0E-17
sp|Q02T57|RS11_PSEAB 30S ribosomal protein S11 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsK PE=3 SV=1 25 146 7.0E-17
sp|B7V666|RS11_PSEA8 30S ribosomal protein S11 OS=Pseudomonas aeruginosa (strain LESB58) GN=rpsK PE=3 SV=1 25 146 7.0E-17
sp|A6UZL1|RS11_PSEA7 30S ribosomal protein S11 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsK PE=3 SV=1 25 146 7.0E-17
sp|C1DKN6|RS11_AZOVD 30S ribosomal protein S11 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsK PE=3 SV=1 25 146 7.0E-17
sp|A9IHR9|RS11_BORPD 30S ribosomal protein S11 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpsK PE=3 SV=1 28 140 8.0E-17
sp|A1ALW5|RS11_PELPD 30S ribosomal protein S11 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsK PE=3 SV=1 28 146 8.0E-17
sp|A4SSY3|RS11_AERS4 30S ribosomal protein S11 OS=Aeromonas salmonicida (strain A449) GN=rpsK PE=3 SV=1 28 146 8.0E-17
sp|A0KF43|RS11_AERHH 30S ribosomal protein S11 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsK PE=3 SV=1 28 146 8.0E-17
sp|Q16AB9|RS11_ROSDO 30S ribosomal protein S11 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsK PE=3 SV=1 24 140 8.0E-17
sp|A4JAR4|RS11_BURVG 30S ribosomal protein S11 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|Q2SU51|RS11_BURTA 30S ribosomal protein S11 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|Q63Q35|RS11_BURPS 30S ribosomal protein S11 OS=Burkholderia pseudomallei (strain K96243) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|A3NEF5|RS11_BURP6 30S ribosomal protein S11 OS=Burkholderia pseudomallei (strain 668) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|Q3JMT7|RS11_BURP1 30S ribosomal protein S11 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|A3P089|RS11_BURP0 30S ribosomal protein S11 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|A1V879|RS11_BURMS 30S ribosomal protein S11 OS=Burkholderia mallei (strain SAVP1) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|Q62GM9|RS11_BURMA 30S ribosomal protein S11 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|A2S7K0|RS11_BURM9 30S ribosomal protein S11 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|A3MRX8|RS11_BURM7 30S ribosomal protein S11 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|A9ADL7|RS11_BURM1 30S ribosomal protein S11 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|Q39KE3|RS11_BURL3 30S ribosomal protein S11 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|Q0BJ22|RS11_BURCM 30S ribosomal protein S11 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|B4E5E4|RS11_BURCJ 30S ribosomal protein S11 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|A0K3P9|RS11_BURCH 30S ribosomal protein S11 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|B1JU46|RS11_BURCC 30S ribosomal protein S11 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|Q1BRX2|RS11_BURCA 30S ribosomal protein S11 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|B1YRQ3|RS11_BURA4 30S ribosomal protein S11 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsK PE=3 SV=1 28 140 9.0E-17
sp|Q8UE40|RS11_AGRFC 30S ribosomal protein S11 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsK PE=3 SV=1 24 146 9.0E-17
sp|Q4ZMR6|RS11_PSEU2 30S ribosomal protein S11 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsK PE=3 SV=1 25 146 9.0E-17
sp|Q889U8|RS11_PSESM 30S ribosomal protein S11 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsK PE=3 SV=1 25 146 9.0E-17
sp|Q3K610|RS11_PSEPF 30S ribosomal protein S11 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpsK PE=3 SV=1 25 146 9.0E-17
sp|C3K2V3|RS11_PSEFS 30S ribosomal protein S11 OS=Pseudomonas fluorescens (strain SBW25) GN=rpsK PE=3 SV=1 25 146 9.0E-17
sp|Q48D59|RS11_PSE14 30S ribosomal protein S11 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsK PE=3 SV=1 25 146 9.0E-17
sp|B5ZZ56|RS11_RHILW 30S ribosomal protein S11 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsK PE=3 SV=1 28 146 9.0E-17
sp|Q1MIB8|RS11_RHIL3 30S ribosomal protein S11 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsK PE=3 SV=1 28 146 9.0E-17
sp|Q2K9J3|RS11_RHIEC 30S ribosomal protein S11 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpsK PE=3 SV=1 28 146 9.0E-17
sp|B3PWU4|RS11_RHIE6 30S ribosomal protein S11 OS=Rhizobium etli (strain CIAT 652) GN=rpsK PE=3 SV=1 28 146 9.0E-17
sp|B9JDV1|RS11_AGRRK 30S ribosomal protein S11 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rpsK PE=3 SV=1 28 146 9.0E-17
sp|Q4K555|RS11_PSEF5 30S ribosomal protein S11 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpsK PE=3 SV=1 25 146 1.0E-16
sp|Q7MPG6|RS11_VIBVY 30S ribosomal protein S11 OS=Vibrio vulnificus (strain YJ016) GN=rpsK PE=3 SV=1 24 146 1.0E-16
sp|P66369|RS11_VIBVU 30S ribosomal protein S11 OS=Vibrio vulnificus (strain CMCP6) GN=rpsK PE=3 SV=1 24 146 1.0E-16
sp|P66368|RS11_VIBPA 30S ribosomal protein S11 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsK PE=3 SV=1 24 146 1.0E-16
sp|C3LRN5|RS11_VIBCM 30S ribosomal protein S11 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsK PE=3 SV=1 24 146 1.0E-16
sp|P66367|RS11_VIBCH 30S ribosomal protein S11 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsK PE=3 SV=1 24 146 1.0E-16
sp|A7N0H6|RS11_VIBCB 30S ribosomal protein S11 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpsK PE=3 SV=1 24 146 1.0E-16
sp|A5F574|RS11_VIBC3 30S ribosomal protein S11 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsK PE=3 SV=1 24 146 1.0E-16
sp|Q2N9D6|RS11_ERYLH 30S ribosomal protein S11 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsK PE=3 SV=1 24 140 1.0E-16
sp|B2VK73|RS11_ERWT9 30S ribosomal protein S11 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpsK PE=3 SV=1 28 146 1.0E-16
sp|Q134V2|RS11_RHOPS 30S ribosomal protein S11 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsK PE=3 SV=1 24 146 1.0E-16
sp|B1LWQ1|RS11_METRJ 30S ribosomal protein S11 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsK PE=3 SV=1 25 146 1.0E-16
sp|B1Z770|RS11_METPB 30S ribosomal protein S11 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsK PE=3 SV=1 25 146 1.0E-16
sp|A9H3J3|RS11_GLUDA 30S ribosomal protein S11 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpsK PE=3 SV=1 18 146 1.0E-16
sp|A4YSL5|RS11_BRASO 30S ribosomal protein S11 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsK PE=3 SV=1 24 146 1.0E-16
sp|Q11HS5|RS11_CHESB 30S ribosomal protein S11 OS=Chelativorans sp. (strain BNC1) GN=rpsK PE=3 SV=1 28 146 1.0E-16
sp|C4L7V3|RS11_TOLAT 30S ribosomal protein S11 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpsK PE=3 SV=1 28 146 1.0E-16
sp|B9JVR0|RS11_AGRVS 30S ribosomal protein S11 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsK PE=3 SV=1 28 146 1.0E-16
sp|Q15X50|RS11_PSEA6 30S ribosomal protein S11 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpsK PE=3 SV=1 24 146 1.0E-16
sp|Q1LTB5|RS11_BAUCH 30S ribosomal protein S11 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsK PE=3 SV=1 24 146 2.0E-16
sp|Q39XY1|RS11_GEOMG 30S ribosomal protein S11 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpsK PE=3 SV=1 28 146 2.0E-16
sp|Q3J8T6|RS11_NITOC 30S ribosomal protein S11 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rpsK PE=3 SV=1 28 140 2.0E-16
sp|B3QBV6|RS11_RHOPT 30S ribosomal protein S11 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsK PE=3 SV=1 25 146 2.0E-16
sp|Q6N4V6|RS11_RHOPA 30S ribosomal protein S11 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsK PE=1 SV=3 25 146 2.0E-16
sp|A6X0E1|RS11_OCHA4 30S ribosomal protein S11 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpsK PE=3 SV=1 28 146 2.0E-16
sp|A8LM80|RS11_DINSH 30S ribosomal protein S11 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpsK PE=3 SV=1 24 140 2.0E-16
sp|P66351|RS11_BRUSU 30S ribosomal protein S11 OS=Brucella suis biovar 1 (strain 1330) GN=rpsK PE=3 SV=1 28 146 2.0E-16
sp|B0CH08|RS11_BRUSI 30S ribosomal protein S11 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpsK PE=3 SV=1 28 146 2.0E-16
sp|A5VQY3|RS11_BRUO2 30S ribosomal protein S11 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpsK PE=3 SV=1 28 146 2.0E-16
sp|P66350|RS11_BRUME 30S ribosomal protein S11 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpsK PE=3 SV=1 28 146 2.0E-16
sp|C0RJH7|RS11_BRUMB 30S ribosomal protein S11 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpsK PE=3 SV=1 28 146 2.0E-16
sp|A9M5M6|RS11_BRUC2 30S ribosomal protein S11 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpsK PE=3 SV=1 28 146 2.0E-16
sp|Q57CT1|RS11_BRUAB 30S ribosomal protein S11 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpsK PE=3 SV=1 28 146 2.0E-16
sp|Q2YRT9|RS11_BRUA2 30S ribosomal protein S11 OS=Brucella abortus (strain 2308) GN=rpsK PE=3 SV=1 28 146 2.0E-16
sp|B2S656|RS11_BRUA1 30S ribosomal protein S11 OS=Brucella abortus (strain S19) GN=rpsK PE=3 SV=1 28 146 2.0E-16
sp|Q1QN07|RS11_NITHX 30S ribosomal protein S11 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsK PE=3 SV=1 25 146 2.0E-16
sp|Q21M35|RS11_SACD2 30S ribosomal protein S11 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpsK PE=3 SV=1 28 146 2.0E-16
sp|P59370|RS11_BRADU 30S ribosomal protein S11 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsK PE=3 SV=1 25 146 2.0E-16
sp|Q1QDG3|RS11_PSYCK 30S ribosomal protein S11 OS=Psychrobacter cryohalolentis (strain K5) GN=rpsK PE=3 SV=1 28 146 2.0E-16
sp|Q4FUD3|RS11_PSYA2 30S ribosomal protein S11 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpsK PE=3 SV=1 28 146 2.0E-16
sp|A5ELK4|RS11_BRASB 30S ribosomal protein S11 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsK PE=3 SV=1 25 146 2.0E-16
sp|Q1GVN5|RS11_SPHAL 30S ribosomal protein S11 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpsK PE=3 SV=1 28 140 2.0E-16
sp|C5CQ77|RS11_VARPS 30S ribosomal protein S11 OS=Variovorax paradoxus (strain S110) GN=rpsK PE=3 SV=1 28 146 2.0E-16
sp|B5FGD9|RS11_VIBFM 30S ribosomal protein S11 OS=Vibrio fischeri (strain MJ11) GN=rpsK PE=3 SV=1 24 146 2.0E-16
sp|Q5E891|RS11_VIBF1 30S ribosomal protein S11 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsK PE=3 SV=1 24 146 2.0E-16
sp|B6EPU7|RS11_ALISL 30S ribosomal protein S11 OS=Aliivibrio salmonicida (strain LFI1238) GN=rpsK PE=3 SV=1 24 146 2.0E-16
sp|B2SQT2|RS11_XANOP 30S ribosomal protein S11 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpsK PE=3 SV=1 28 146 3.0E-16
sp|Q2P007|RS11_XANOM 30S ribosomal protein S11 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpsK PE=3 SV=1 28 146 3.0E-16
sp|P0A0X2|RS11_XANCP 30S ribosomal protein S11 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpsK PE=3 SV=1 28 146 3.0E-16
sp|B0RU60|RS11_XANCB 30S ribosomal protein S11 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpsK PE=3 SV=1 28 146 3.0E-16
sp|Q4URG1|RS11_XANC8 30S ribosomal protein S11 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpsK PE=3 SV=1 28 146 3.0E-16
sp|Q3BWW1|RS11_XANC5 30S ribosomal protein S11 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpsK PE=3 SV=1 28 146 3.0E-16
sp|P0A0X3|RS11_XANAC 30S ribosomal protein S11 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpsK PE=3 SV=1 28 146 3.0E-16
sp|Q3SSU3|RS11_NITWN 30S ribosomal protein S11 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsK PE=3 SV=1 25 146 3.0E-16
sp|B2FQK6|RS11_STRMK 30S ribosomal protein S11 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsK PE=3 SV=1 28 146 3.0E-16
sp|B4SLH3|RS11_STRM5 30S ribosomal protein S11 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsK PE=3 SV=1 28 146 3.0E-16
sp|A5FZU2|RS11_ACICJ 30S ribosomal protein S11 OS=Acidiphilium cryptum (strain JF-5) GN=rpsK PE=3 SV=1 28 146 3.0E-16
sp|Q3IJK7|RS11_PSEHT 30S ribosomal protein S11 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpsK PE=3 SV=1 24 146 3.0E-16
sp|Q211H1|RS11_RHOPB 30S ribosomal protein S11 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpsK PE=3 SV=1 25 146 3.0E-16
sp|Q07KP1|RS11_RHOP5 30S ribosomal protein S11 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsK PE=3 SV=1 25 146 3.0E-16
sp|Q6LV93|RS11_PHOPR 30S ribosomal protein S11 OS=Photobacterium profundum GN=rpsK PE=3 SV=1 24 146 3.0E-16
sp|A6W369|RS11_MARMS 30S ribosomal protein S11 OS=Marinomonas sp. (strain MWYL1) GN=rpsK PE=3 SV=1 28 146 3.0E-16
sp|Q2IXN7|RS11_RHOP2 30S ribosomal protein S11 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsK PE=3 SV=1 25 146 3.0E-16
sp|B7VLD4|RS11_VIBTL 30S ribosomal protein S11 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsK PE=3 SV=1 24 146 4.0E-16
sp|B1KMW0|RS11_SHEWM 30S ribosomal protein S11 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpsK PE=3 SV=1 24 146 4.0E-16
sp|Q9S0R0|RS11_SHEVD 30S ribosomal protein S11 OS=Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12) GN=rpsK PE=3 SV=2 24 146 4.0E-16
sp|B8CNF6|RS11_SHEPW 30S ribosomal protein S11 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpsK PE=3 SV=1 24 146 4.0E-16
sp|A8GYZ8|RS11_SHEPA 30S ribosomal protein S11 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpsK PE=3 SV=1 24 146 4.0E-16
sp|B0TLZ0|RS11_SHEHH 30S ribosomal protein S11 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpsK PE=3 SV=1 24 146 4.0E-16
sp|A8G1C7|RS11_SHESH 30S ribosomal protein S11 OS=Shewanella sediminis (strain HAW-EB3) GN=rpsK PE=3 SV=1 24 146 4.0E-16
sp|Q6FZE5|RS11_BARQU 30S ribosomal protein S11 OS=Bartonella quintana (strain Toulouse) GN=rpsK PE=3 SV=1 25 146 4.0E-16
sp|A1B051|RS11_PARDP 30S ribosomal protein S11 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpsK PE=3 SV=1 25 140 5.0E-16
sp|B1LBL4|RS11_THESQ 30S ribosomal protein S11 OS=Thermotoga sp. (strain RQ2) GN=rpsK PE=3 SV=1 27 146 5.0E-16
sp|A5IMA9|RS11_THEP1 30S ribosomal protein S11 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsK PE=3 SV=1 27 146 5.0E-16
sp|Q7VQC5|RS11_BLOFL 30S ribosomal protein S11 OS=Blochmannia floridanus GN=rpsK PE=3 SV=1 28 146 5.0E-16
sp|Q21QP7|RS11_RHOFT 30S ribosomal protein S11 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsK PE=3 SV=1 28 146 6.0E-16
sp|Q089N1|RS11_SHEFN 30S ribosomal protein S11 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpsK PE=3 SV=1 24 146 6.0E-16
sp|A8ZV80|RS11_DESOH 30S ribosomal protein S11 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rpsK PE=3 SV=1 28 140 7.0E-16
sp|B0V6U5|RS11_ACIBY 30S ribosomal protein S11 OS=Acinetobacter baumannii (strain AYE) GN=rpsK PE=3 SV=1 28 146 7.0E-16
sp|A3M961|RS11_ACIBT 30S ribosomal protein S11 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpsK PE=3 SV=2 28 146 7.0E-16
sp|B0VQU1|RS11_ACIBS 30S ribosomal protein S11 OS=Acinetobacter baumannii (strain SDF) GN=rpsK PE=3 SV=1 28 146 7.0E-16
sp|B2HZ85|RS11_ACIBC 30S ribosomal protein S11 OS=Acinetobacter baumannii (strain ACICU) GN=rpsK PE=3 SV=1 28 146 7.0E-16
sp|B7IA16|RS11_ACIB5 30S ribosomal protein S11 OS=Acinetobacter baumannii (strain AB0057) GN=rpsK PE=3 SV=1 28 146 7.0E-16
sp|B7GW25|RS11_ACIB3 30S ribosomal protein S11 OS=Acinetobacter baumannii (strain AB307-0294) GN=rpsK PE=3 SV=1 28 146 7.0E-16
sp|Q6F7T5|RS11_ACIAD 30S ribosomal protein S11 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpsK PE=3 SV=1 28 146 7.0E-16
sp|A3Q9A5|RS11_SHELP 30S ribosomal protein S11 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsK PE=3 SV=1 24 146 7.0E-16
sp|Q12ST6|RS11_SHEDO 30S ribosomal protein S11 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpsK PE=3 SV=1 24 146 9.0E-16
sp|Q9X1I4|RS11_THEMA 30S ribosomal protein S11 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsK PE=3 SV=1 27 146 9.0E-16
sp|Q5QXV6|RS11_IDILO 30S ribosomal protein S11 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpsK PE=3 SV=1 24 146 9.0E-16
sp|Q12G79|RS11_POLSJ 30S ribosomal protein S11 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsK PE=3 SV=1 28 146 1.0E-15
sp|A1VJ38|RS11_POLNA 30S ribosomal protein S11 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpsK PE=3 SV=1 28 146 1.0E-15
sp|A1S241|RS11_SHEAM 30S ribosomal protein S11 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsK PE=3 SV=1 24 146 1.0E-15
sp|A0L5Z6|RS11_MAGMM 30S ribosomal protein S11 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsK PE=3 SV=1 24 140 1.0E-15
sp|A1TJU0|RS11_ACIAC 30S ribosomal protein S11 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsK PE=3 SV=1 28 146 1.0E-15
sp|B9K8B2|RS11_THENN 30S ribosomal protein S11 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpsK PE=3 SV=1 27 146 1.0E-15
sp|A1W331|RS11_ACISJ 30S ribosomal protein S11 OS=Acidovorax sp. (strain JS42) GN=rpsK PE=3 SV=1 28 146 1.0E-15
sp|B9MBW0|RS11_ACIET 30S ribosomal protein S11 OS=Acidovorax ebreus (strain TPSY) GN=rpsK PE=3 SV=1 28 146 1.0E-15
sp|A5CXI7|RS11_VESOH 30S ribosomal protein S11 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rpsK PE=3 SV=1 28 146 2.0E-15
sp|Q1GK05|RS11_RUEST 30S ribosomal protein S11 OS=Ruegeria sp. (strain TM1040) GN=rpsK PE=3 SV=1 24 140 2.0E-15
sp|Q5LW33|RS11_RUEPO 30S ribosomal protein S11 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsK PE=3 SV=1 24 140 2.0E-15
sp|A9BRX3|RS11_DELAS 30S ribosomal protein S11 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsK PE=3 SV=1 28 146 2.0E-15
sp|A1AVM3|RS11_RUTMC 30S ribosomal protein S11 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rpsK PE=3 SV=1 25 146 2.0E-15
sp|P59586|RS11_XYLFT 30S ribosomal protein S11 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpsK PE=3 SV=1 28 146 2.0E-15
sp|B2I8J1|RS11_XYLF2 30S ribosomal protein S11 OS=Xylella fastidiosa (strain M23) GN=rpsK PE=3 SV=1 28 146 2.0E-15
sp|B0U5M1|RS11_XYLFM 30S ribosomal protein S11 OS=Xylella fastidiosa (strain M12) GN=rpsK PE=3 SV=1 28 146 2.0E-15
sp|O66485|RS11_AQUAE 30S ribosomal protein S11 OS=Aquifex aeolicus (strain VF5) GN=rpsK PE=3 SV=1 24 146 3.0E-15
sp|Q28US9|RS11_JANSC 30S ribosomal protein S11 OS=Jannaschia sp. (strain CCS1) GN=rpsK PE=3 SV=1 24 140 3.0E-15
sp|Q2LQD1|RS11_SYNAS 30S ribosomal protein S11 OS=Syntrophus aciditrophicus (strain SB) GN=rpsK PE=3 SV=1 28 146 3.0E-15
sp|B5Y962|RS11_COPPD 30S ribosomal protein S11 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=rpsK PE=3 SV=1 27 146 3.0E-15
sp|Q2S935|RS11_HAHCH 30S ribosomal protein S11 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsK PE=3 SV=1 25 146 3.0E-15
sp|A1WK94|RS11_VEREI 30S ribosomal protein S11 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsK PE=3 SV=1 28 146 3.0E-15
sp|Q0BUM7|RS11_GRABC 30S ribosomal protein S11 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsK PE=3 SV=1 28 146 3.0E-15
sp|Q6G2Y8|RS11_BARHE 30S ribosomal protein S11 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsK PE=3 SV=1 28 146 4.0E-15
sp|Q73PK9|RS11_TREDE 30S ribosomal protein S11 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rpsK PE=3 SV=1 28 146 4.0E-15
sp|A1TYM0|RS11_MARHV 30S ribosomal protein S11 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsK PE=3 SV=1 25 146 4.0E-15
sp|Q749B1|RS11_GEOSL 30S ribosomal protein S11 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rpsK PE=3 SV=1 28 146 5.0E-15
sp|A5WCL2|RS11_PSYWF 30S ribosomal protein S11 OS=Psychrobacter sp. (strain PRwf-1) GN=rpsK PE=3 SV=1 28 140 6.0E-15
sp|Q5P309|RS11_AROAE 30S ribosomal protein S11 OS=Aromatoleum aromaticum (strain EbN1) GN=rpsK PE=3 SV=1 28 146 6.0E-15
sp|A1WV99|RS11_HALHL 30S ribosomal protein S11 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsK PE=3 SV=1 28 140 6.0E-15
sp|Q9PE54|RS11_XYLFA 30S ribosomal protein S11 OS=Xylella fastidiosa (strain 9a5c) GN=rpsK PE=3 SV=1 28 146 6.0E-15
sp|A6T3I0|RS11_JANMA 30S ribosomal protein S11 OS=Janthinobacterium sp. (strain Marseille) GN=rpsK PE=3 SV=1 28 140 7.0E-15
sp|A9IVZ7|RS11_BART1 30S ribosomal protein S11 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpsK PE=3 SV=1 28 146 8.0E-15
sp|A1KB03|RS11_AZOSB 30S ribosomal protein S11 OS=Azoarcus sp. (strain BH72) GN=rpsK PE=3 SV=1 28 146 8.0E-15
sp|A5EX96|RS11_DICNV 30S ribosomal protein S11 OS=Dichelobacter nodosus (strain VCS1703A) GN=rpsK PE=3 SV=1 35 140 9.0E-15
sp|A4G9R5|RS11_HERAR 30S ribosomal protein S11 OS=Herminiimonas arsenicoxydans GN=rpsK PE=3 SV=1 28 140 1.0E-14
sp|P59484|RS11_BUCBP 30S ribosomal protein S11 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpsK PE=3 SV=1 24 146 2.0E-14
sp|Q1H4L3|RS11_METFK 30S ribosomal protein S11 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rpsK PE=3 SV=1 28 146 2.0E-14
sp|Q1R0F2|RS11_CHRSD 30S ribosomal protein S11 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsK PE=3 SV=1 24 146 2.0E-14
sp|B9DM52|RS11_STACT 30S ribosomal protein S11 OS=Staphylococcus carnosus (strain TM300) GN=rpsK PE=3 SV=1 28 140 2.0E-14
sp|Q31IW0|RS11_THICR 30S ribosomal protein S11 OS=Thiomicrospira crunogena (strain XCL-2) GN=rpsK PE=3 SV=1 29 146 2.0E-14
sp|Q49ZE3|RS11_STAS1 30S ribosomal protein S11 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpsK PE=3 SV=1 28 140 2.0E-14
sp|A1RED7|RS11_SHESW 30S ribosomal protein S11 OS=Shewanella sp. (strain W3-18-1) GN=rpsK PE=3 SV=1 24 146 3.0E-14
sp|Q0I082|RS11_SHESR 30S ribosomal protein S11 OS=Shewanella sp. (strain MR-7) GN=rpsK PE=3 SV=1 24 146 3.0E-14
sp|Q0HNR4|RS11_SHESM 30S ribosomal protein S11 OS=Shewanella sp. (strain MR-4) GN=rpsK PE=3 SV=1 24 146 3.0E-14
sp|A0KRP7|RS11_SHESA 30S ribosomal protein S11 OS=Shewanella sp. (strain ANA-3) GN=rpsK PE=3 SV=1 24 146 3.0E-14
sp|A4YBW0|RS11_SHEPC 30S ribosomal protein S11 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsK PE=3 SV=1 24 146 3.0E-14
sp|P59375|RS11_SHEON 30S ribosomal protein S11 OS=Shewanella oneidensis (strain MR-1) GN=rpsK PE=3 SV=1 24 146 3.0E-14
sp|A9KWC4|RS11_SHEB9 30S ribosomal protein S11 OS=Shewanella baltica (strain OS195) GN=rpsK PE=3 SV=1 24 146 3.0E-14
sp|A6WHV1|RS11_SHEB8 30S ribosomal protein S11 OS=Shewanella baltica (strain OS185) GN=rpsK PE=3 SV=1 24 146 3.0E-14
sp|A3DA49|RS11_SHEB5 30S ribosomal protein S11 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsK PE=3 SV=1 24 146 3.0E-14
sp|B8EBI2|RS11_SHEB2 30S ribosomal protein S11 OS=Shewanella baltica (strain OS223) GN=rpsK PE=3 SV=1 24 146 3.0E-14
sp|Q4L889|RS11_STAHJ 30S ribosomal protein S11 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|P66358|RS11_STAAW 30S ribosomal protein S11 OS=Staphylococcus aureus (strain MW2) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|A8Z332|RS11_STAAT 30S ribosomal protein S11 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|Q6G796|RS11_STAAS 30S ribosomal protein S11 OS=Staphylococcus aureus (strain MSSA476) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|Q6GEK8|RS11_STAAR 30S ribosomal protein S11 OS=Staphylococcus aureus (strain MRSA252) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|P66357|RS11_STAAN 30S ribosomal protein S11 OS=Staphylococcus aureus (strain N315) GN=rpsK PE=1 SV=1 28 140 3.0E-14
sp|P66356|RS11_STAAM 30S ribosomal protein S11 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|A6QJ67|RS11_STAAE 30S ribosomal protein S11 OS=Staphylococcus aureus (strain Newman) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|Q5HDY3|RS11_STAAC 30S ribosomal protein S11 OS=Staphylococcus aureus (strain COL) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|Q2YYM1|RS11_STAAB 30S ribosomal protein S11 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|A5IV09|RS11_STAA9 30S ribosomal protein S11 OS=Staphylococcus aureus (strain JH9) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|Q2FW31|RS11_STAA8 30S ribosomal protein S11 OS=Staphylococcus aureus (strain NCTC 8325) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|Q2FER4|RS11_STAA3 30S ribosomal protein S11 OS=Staphylococcus aureus (strain USA300) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|A6U3V0|RS11_STAA2 30S ribosomal protein S11 OS=Staphylococcus aureus (strain JH1) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|A7X5C5|RS11_STAA1 30S ribosomal protein S11 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|A6LLN9|RS11_THEM4 30S ribosomal protein S11 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpsK PE=3 SV=1 28 145 3.0E-14
sp|P59377|RS11_STAES 30S ribosomal protein S11 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|Q5HM24|RS11_STAEQ 30S ribosomal protein S11 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|Q605D5|RS11_METCA 30S ribosomal protein S11 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsK PE=3 SV=1 28 146 3.0E-14
sp|Q3A6M2|RS11_PELCD 30S ribosomal protein S11 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsK PE=3 SV=1 28 140 3.0E-14
sp|Q47J79|RS11_DECAR 30S ribosomal protein S11 OS=Dechloromonas aromatica (strain RCB) GN=rpsK PE=3 SV=1 28 146 5.0E-14
sp|B5XJ61|RS11_STRPZ 30S ribosomal protein S11 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rpsK PE=3 SV=1 27 140 6.0E-14
sp|A8F4T7|RS11_PSELT 30S ribosomal protein S11 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpsK PE=3 SV=1 28 146 6.0E-14
sp|C4K795|RS11_HAMD5 30S ribosomal protein S11 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rpsK PE=3 SV=1 29 140 6.0E-14
sp|A7HWT4|RS11_PARL1 30S ribosomal protein S11 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsK PE=3 SV=1 28 140 8.0E-14
sp|C5CGH6|RS11_KOSOT 30S ribosomal protein S11 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpsK PE=3 SV=1 28 137 8.0E-14
sp|Q2G5A9|RS11_NOVAD 30S ribosomal protein S11 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpsK PE=3 SV=1 25 146 8.0E-14
sp|Q0ABF2|RS11_ALKEH 30S ribosomal protein S11 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsK PE=3 SV=1 25 140 1.0E-13
sp|A9NEF9|RS11_ACHLI 30S ribosomal protein S11 OS=Acholeplasma laidlawii (strain PG-8A) GN=rpsK PE=3 SV=1 28 140 1.0E-13
sp|Q03PY2|RS11_LACBA 30S ribosomal protein S11 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsK PE=3 SV=1 28 140 2.0E-13
sp|A6LEG7|RS11_PARD8 30S ribosomal protein S11 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsK PE=3 SV=1 5 146 2.0E-13
sp|C1DAU1|RS11_LARHH 30S ribosomal protein S11 OS=Laribacter hongkongensis (strain HLHK9) GN=rpsK PE=3 SV=1 28 146 2.0E-13
sp|B9L6T9|RS11_NAUPA 30S ribosomal protein S11 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rpsK PE=3 SV=1 28 146 2.0E-13
sp|B7IHX1|RS11_THEAB 30S ribosomal protein S11 OS=Thermosipho africanus (strain TCF52B) GN=rpsK PE=3 SV=1 28 145 3.0E-13
sp|A5N4S3|RS11_CLOK5 30S ribosomal protein S11 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpsK PE=3 SV=1 27 140 3.0E-13
sp|B9DYD5|RS11_CLOK1 30S ribosomal protein S11 OS=Clostridium kluyveri (strain NBRC 12016) GN=rpsK PE=3 SV=1 27 140 3.0E-13
sp|B1YGX6|RS11_EXIS2 30S ribosomal protein S11 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpsK PE=3 SV=1 28 140 4.0E-13
sp|C1CPB3|RS11_STRZT 30S ribosomal protein S11 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|C1CIC2|RS11_STRZP 30S ribosomal protein S11 OS=Streptococcus pneumoniae (strain P1031) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|C1CC31|RS11_STRZJ 30S ribosomal protein S11 OS=Streptococcus pneumoniae (strain JJA) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|A3CK89|RS11_STRSV 30S ribosomal protein S11 OS=Streptococcus sanguinis (strain SK36) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|P66360|RS11_STRR6 30S ribosomal protein S11 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|B2IS66|RS11_STRPS 30S ribosomal protein S11 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|P66359|RS11_STRPN 30S ribosomal protein S11 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|B8ZKQ4|RS11_STRPJ 30S ribosomal protein S11 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|B1I8M3|RS11_STRPI 30S ribosomal protein S11 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|C1CAN7|RS11_STRP7 30S ribosomal protein S11 OS=Streptococcus pneumoniae (strain 70585) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|B5E6H9|RS11_STRP4 30S ribosomal protein S11 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|Q04ML2|RS11_STRP2 30S ribosomal protein S11 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|A8AZK0|RS11_STRGC 30S ribosomal protein S11 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|B3EP36|RS11_CHLPB 30S ribosomal protein S11 OS=Chlorobium phaeobacteroides (strain BS1) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|A1KRJ7|RS11_NEIMF 30S ribosomal protein S11 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|P66355|RS11_NEIMB 30S ribosomal protein S11 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|P66354|RS11_NEIMA 30S ribosomal protein S11 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|A9M3U2|RS11_NEIM0 30S ribosomal protein S11 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|Q5F5V0|RS11_NEIG1 30S ribosomal protein S11 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpsK PE=3 SV=1 28 140 5.0E-13
sp|Q03IH6|RS11_STRTD 30S ribosomal protein S11 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpsK PE=3 SV=1 28 140 6.0E-13
sp|Q5M2D8|RS11_STRT2 30S ribosomal protein S11 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpsK PE=3 SV=1 28 140 6.0E-13
sp|Q5LXT6|RS11_STRT1 30S ribosomal protein S11 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpsK PE=3 SV=1 28 140 6.0E-13
sp|B9E9L6|RS11_MACCJ 30S ribosomal protein S11 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rpsK PE=3 SV=1 28 140 6.0E-13
sp|B9DSX5|RS11_STRU0 30S ribosomal protein S11 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|C0ME30|RS11_STRS7 30S ribosomal protein S11 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|P0DE65|RS11_STRPQ 30S ribosomal protein S11 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|Q48VS4|RS11_STRPM 30S ribosomal protein S11 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|A2RC39|RS11_STRPG 30S ribosomal protein S11 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|Q1J8Y8|RS11_STRPF 30S ribosomal protein S11 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|Q1JJ36|RS11_STRPD 30S ribosomal protein S11 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|Q1JNZ2|RS11_STRPC 30S ribosomal protein S11 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|Q1JE34|RS11_STRPB 30S ribosomal protein S11 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|P66362|RS11_STRP8 30S ribosomal protein S11 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|Q5XEB0|RS11_STRP6 30S ribosomal protein S11 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|P0DE64|RS11_STRP3 30S ribosomal protein S11 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|B4U525|RS11_STREM 30S ribosomal protein S11 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|C0M7C6|RS11_STRE4 30S ribosomal protein S11 OS=Streptococcus equi subsp. equi (strain 4047) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|P66364|RS11_STRA5 30S ribosomal protein S11 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|P66363|RS11_STRA3 30S ribosomal protein S11 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|Q3K3U5|RS11_STRA1 30S ribosomal protein S11 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpsK PE=3 SV=2 28 140 7.0E-13
sp|A4VSH7|RS11_STRSY 30S ribosomal protein S11 OS=Streptococcus suis (strain 05ZYH33) GN=rpsK PE=3 SV=2 28 140 7.0E-13
sp|A4VYR7|RS11_STRS2 30S ribosomal protein S11 OS=Streptococcus suis (strain 98HAH33) GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|Q9A1V0|RS11_STRP1 30S ribosomal protein S11 OS=Streptococcus pyogenes serotype M1 GN=rpsK PE=3 SV=1 28 140 7.0E-13
sp|A9BFZ2|RS11_PETMO 30S ribosomal protein S11 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpsK PE=3 SV=1 31 145 7.0E-13
sp|B0YPQ8|RR11_ANEMR 30S ribosomal protein S11, plastid OS=Aneura mirabilis GN=rps11 PE=3 SV=1 28 146 8.0E-13
sp|P59378|RS11_STRMU 30S ribosomal protein S11 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpsK PE=3 SV=1 28 140 8.0E-13
sp|P56018|RS11_HELPY 30S ribosomal protein S11 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpsK PE=3 SV=1 11 140 9.0E-13
sp|Q6F1W8|RS11_MESFL 30S ribosomal protein S11 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpsK PE=3 SV=1 28 142 9.0E-13
sp|B1GZA8|RS11_UNCTG 30S ribosomal protein S11 OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=rpsK PE=3 SV=1 30 140 1.0E-12
sp|Q9ZJT3|RS11_HELPJ 30S ribosomal protein S11 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpsK PE=3 SV=1 11 140 1.0E-12
sp|B5Z8U4|RS11_HELPG 30S ribosomal protein S11 OS=Helicobacter pylori (strain G27) GN=rpsK PE=3 SV=1 11 140 1.0E-12
sp|B6YQ62|RS11_AZOPC 30S ribosomal protein S11 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rpsK PE=3 SV=1 28 146 1.0E-12
sp|B2S2F9|RS11_TREPS 30S ribosomal protein S11 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rpsK PE=3 SV=1 28 146 1.0E-12
sp|O83241|RS11_TREPA 30S ribosomal protein S11 OS=Treponema pallidum (strain Nichols) GN=rpsK PE=3 SV=1 28 146 1.0E-12
sp|Q7M8F5|RS11_WOLSU 30S ribosomal protein S11 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpsK PE=3 SV=1 28 140 1.0E-12
sp|Q04G61|RS11_OENOB 30S ribosomal protein S11 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpsK PE=3 SV=1 28 146 1.0E-12
sp|A2T366|RR11_ANGEV 30S ribosomal protein S11, chloroplastic OS=Angiopteris evecta GN=rps11 PE=3 SV=1 28 146 2.0E-12
sp|Q1CRW5|RS11_HELPH 30S ribosomal protein S11 OS=Helicobacter pylori (strain HPAG1) GN=rpsK PE=3 SV=1 28 140 2.0E-12
sp|B6JND5|RS11_HELP2 30S ribosomal protein S11 OS=Helicobacter pylori (strain P12) GN=rpsK PE=3 SV=1 28 140 2.0E-12
sp|Q5WZI9|RS11_LEGPL 30S ribosomal protein S11 OS=Legionella pneumophila (strain Lens) GN=rpsK PE=3 SV=1 28 146 2.0E-12
sp|Q5ZYM0|RS11_LEGPH 30S ribosomal protein S11 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpsK PE=3 SV=1 28 146 2.0E-12
sp|Q5X836|RS11_LEGPA 30S ribosomal protein S11 OS=Legionella pneumophila (strain Paris) GN=rpsK PE=3 SV=1 28 146 2.0E-12
sp|A9W4R7|RS11_METEP 30S ribosomal protein S11 OS=Methylobacterium extorquens (strain PA1) GN=rpsK PE=3 SV=1 25 146 3.0E-12
sp|B7L0S7|RS11_METC4 30S ribosomal protein S11 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsK PE=3 SV=1 25 146 3.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043604 amide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0044267 cellular protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0005198 structural molecule activity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0043229 intracellular organelle No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043043 peptide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6597
MPPPKKVAAPKENISLGPSVRDGELVFGVARIFASFNDTFVHVTDLSGRETITRVTGGMKVKADRDESSPYAAML
AAQDVAARCKELGINALHIKIRATGGNGTKTPGPGAQSALRALARAGMKIGRIEDVTPTPSDSTRRKGGRRGRRL
*
Coding >Hirsu2|6597
ATGCCCCCCCCCAAGAAGGTAGCCGCTCCCAAGGAGAACATCTCCCTGGGCCCCTCCGTTCGCGATGGCGAGCTC
GTCTTCGGCGTTGCTCGTATCTTCGCCTCCTTCAACGACACCTTCGTCCACGTCACCGATCTGAGCGGCCGTGAG
ACCATCACCCGGGTGACCGGTGGCATGAAGGTCAAGGCCGACCGTGACGAGTCCTCCCCCTACGCCGCCATGTTG
GCTGCTCAGGACGTTGCCGCGCGATGCAAGGAGCTGGGGATCAACGCCCTCCACATCAAGATCCGCGCCACCGGT
GGCAACGGCACCAAGACCCCTGGCCCCGGTGCTCAGTCGGCCCTTCGCGCGCTCGCCCGTGCCGGCATGAAGATT
GGCCGCATCGAGGACGTCACCCCGACTCCTTCCGACTCCACCCGCAGAAAGGGCGGTCGCCGTGGTCGTCGTCTC
TGA
Transcript >Hirsu2|6597
ATGCCCCCCCCCAAGAAGGTAGCCGCTCCCAAGGAGAACATCTCCCTGGGCCCCTCCGTTCGCGATGGCGAGCTC
GTCTTCGGCGTTGCTCGTATCTTCGCCTCCTTCAACGACACCTTCGTCCACGTCACCGATCTGAGCGGCCGTGAG
ACCATCACCCGGGTGACCGGTGGCATGAAGGTCAAGGCCGACCGTGACGAGTCCTCCCCCTACGCCGCCATGTTG
GCTGCTCAGGACGTTGCCGCGCGATGCAAGGAGCTGGGGATCAACGCCCTCCACATCAAGATCCGCGCCACCGGT
GGCAACGGCACCAAGACCCCTGGCCCCGGTGCTCAGTCGGCCCTTCGCGCGCTCGCCCGTGCCGGCATGAAGATT
GGCCGCATCGAGGACGTCACCCCGACTCCTTCCGACTCCACCCGCAGAAAGGGCGGTCGCCGTGGTCGTCGTCTC
TGA
Gene >Hirsu2|6597
ATGCCCCCCCCCAAGAAGGTAGCCGCTCCCAAGGAGAACATCTCCCTGGGCCCCTCCGTTCGCGATGGTAACGTT
TTCCTCCCCGCCATTGACGCCGATTCTCTGGCTCTTGCCCCGGCACCTTCGTGACTGACGATATGGGTCTCATGC
AGGCGAGCTCGTCTTCGGCGTTGCTCGTATCTTCGCCTCCTTCAACGACACCTTCGTCCACGTCACCGATCTGAG
GTTCGTCGACTCCGGGCACAACGCACATTTCATGGCGCCGATGCTAACGCGCGCGACAGCGGCCGTGAGACCATC
ACCCGGGTGACCGGTGGCATGAAGGTCAAGGCCGACCGTGACGAGTCCTCCCCCTACGCCGCCATGTTGGCTGCT
CAGGACGTTGCCGCGCGATGCAAGGAGCTGGGGATCAACGCCCTCCACATCAAGATCCGCGCCACCGGTGGTATG
TCCTCTCCTCCACGGGTCGACGGGAGCCCCCGGCGTAACTGACCGGAAAACCCTTCAGGCAACGGCACCAAGACC
CCTGGCCCCGGTGCTCAGTCGGCCCTTCGCGCGCTCGCCCGTGCCGGCATGAAGATTGGCCGCATCGAGGACGTC
ACCCCGACTCCTTCCGACTCCACCCGCAGAAAGGGCGGTCGCCGTGGTCGTCGTCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail