Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6596
Gene name
LocationContig_342:19548..21045
Strand-
Gene length (bp)1497
Transcript length (bp)750
Coding sequence length (bp)750
Protein length (aa) 250

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08079 Ribosomal_L30_N Ribosomal L30 N-terminal domain 9.8E-26 14 85
PF00327 Ribosomal_L30 Ribosomal protein L30p/L7e 1.4E-19 90 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SBD5|RL7_NEUCR 60S ribosomal protein L7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpl-7 PE=3 SV=2 3 249 3.0E-140
sp|Q6C603|RL7_YARLI 60S ribosomal protein L7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPL7 PE=3 SV=1 1 249 3.0E-121
sp|Q6BTA4|RL7_DEBHA 60S ribosomal protein L7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPL7 PE=3 SV=1 13 249 5.0E-118
sp|O60143|RL7C_SCHPO 60S ribosomal protein L7-C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl701 PE=1 SV=1 1 248 7.0E-114
sp|P25457|RL7B_SCHPO 60S ribosomal protein L7-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl702 PE=3 SV=1 1 248 3.0E-113
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SBD5|RL7_NEUCR 60S ribosomal protein L7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpl-7 PE=3 SV=2 3 249 3.0E-140
sp|Q6C603|RL7_YARLI 60S ribosomal protein L7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPL7 PE=3 SV=1 1 249 3.0E-121
sp|Q6BTA4|RL7_DEBHA 60S ribosomal protein L7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPL7 PE=3 SV=1 13 249 5.0E-118
sp|O60143|RL7C_SCHPO 60S ribosomal protein L7-C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl701 PE=1 SV=1 1 248 7.0E-114
sp|P25457|RL7B_SCHPO 60S ribosomal protein L7-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl702 PE=3 SV=1 1 248 3.0E-113
sp|Q755A7|RL7_ASHGO 60S ribosomal protein L7 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPL7 PE=3 SV=1 10 249 9.0E-106
sp|P05737|RL7A_YEAST 60S ribosomal protein L7-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL7A PE=1 SV=3 10 249 6.0E-104
sp|Q12213|RL7B_YEAST 60S ribosomal protein L7-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL7B PE=1 SV=3 8 249 9.0E-104
sp|Q6FSN6|RL7_CANGA 60S ribosomal protein L7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPL7 PE=3 SV=1 10 249 7.0E-103
sp|O01802|RL7_CAEEL 60S ribosomal protein L7 OS=Caenorhabditis elegans GN=rpl-7 PE=3 SV=1 7 248 7.0E-102
sp|P60040|RL72_ARATH 60S ribosomal protein L7-2 OS=Arabidopsis thaliana GN=RPL7B PE=2 SV=1 10 249 2.0E-100
sp|Q5ZJ56|RL7_CHICK 60S ribosomal protein L7 OS=Gallus gallus GN=RPL7 PE=2 SV=1 3 249 4.0E-100
sp|Q58DT1|RL7_BOVIN 60S ribosomal protein L7 OS=Bos taurus GN=RPL7 PE=2 SV=1 14 249 3.0E-99
sp|Q5R9R4|RL7_PONAB 60S ribosomal protein L7 OS=Pongo abelii GN=RPL7 PE=2 SV=1 14 249 6.0E-99
sp|P18124|RL7_HUMAN 60S ribosomal protein L7 OS=Homo sapiens GN=RPL7 PE=1 SV=1 14 249 6.0E-99
sp|P05426|RL7_RAT 60S ribosomal protein L7 OS=Rattus norvegicus GN=Rpl7 PE=1 SV=2 14 249 2.0E-98
sp|P14148|RL7_MOUSE 60S ribosomal protein L7 OS=Mus musculus GN=Rpl7 PE=1 SV=2 14 249 3.0E-98
sp|Q9LHP1|RL74_ARATH 60S ribosomal protein L7-4 OS=Arabidopsis thaliana GN=RPL7D PE=2 SV=1 10 249 8.0E-98
sp|Q4R506|RL7_MACFA 60S ribosomal protein L7 OS=Macaca fascicularis GN=RPL7 PE=2 SV=1 14 249 1.0E-97
sp|P60039|RL73_ARATH 60S ribosomal protein L7-3 OS=Arabidopsis thaliana GN=RPL7C PE=2 SV=1 10 249 1.0E-97
sp|P32100|RL7_DROME 60S ribosomal protein L7 OS=Drosophila melanogaster GN=RpL7 PE=1 SV=2 14 248 6.0E-88
sp|P11874|RL7_DICDI 60S ribosomal protein L7 OS=Dictyostelium discoideum GN=rpl7 PE=1 SV=3 14 249 2.0E-85
sp|P17937|RL7A_SCHPO 60S ribosomal protein L7-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rlp7 PE=3 SV=1 3 247 3.0E-84
sp|P0DJ13|RL7_TETTH 60S ribosomal protein L7 OS=Tetrahymena thermophila GN=RPL7 PE=1 SV=1 13 248 1.0E-76
sp|A0CEY2|RL71_PARTE 60S ribosomal protein L7 1 OS=Paramecium tetraurelia GN=Rpl7-1 PE=3 SV=1 14 248 3.0E-75
sp|A0BD73|RL72_PARTE 60S ribosomal protein L7 2 OS=Paramecium tetraurelia GN=Rpl7-2 PE=3 SV=1 14 248 7.0E-75
sp|Q6DKI1|RL7L_HUMAN 60S ribosomal protein L7-like 1 OS=Homo sapiens GN=RPL7L1 PE=1 SV=1 13 249 8.0E-58
sp|Q5RAH8|RL7L_PONAB 60S ribosomal protein L7-like 1 OS=Pongo abelii GN=RPL7L1 PE=2 SV=1 13 249 1.0E-56
sp|Q9SAI5|RL71_ARATH 60S ribosomal protein L7-1 OS=Arabidopsis thaliana GN=RPL7A PE=2 SV=1 14 249 1.0E-54
sp|Q9D8M4|RL7L_MOUSE 60S ribosomal protein L7-like 1 OS=Mus musculus GN=Rpl7l1 PE=1 SV=1 13 249 6.0E-53
sp|A5GFQ0|RL7L_PIG 60S ribosomal protein L7-like 1 OS=Sus scrofa GN=RPL7L1 PE=3 SV=1 13 249 3.0E-50
sp|Q6BIF5|RLP7_DEBHA Ribosome biogenesis protein RLP7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RLP7 PE=3 SV=2 15 223 2.0E-39
sp|P32102|RLP7_KLULA Ribosome biogenesis protein RLP7 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RLP7 PE=3 SV=2 15 220 2.0E-39
sp|Q75ET5|RLP7_ASHGO Ribosome biogenesis protein RLP7 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RLP7 PE=3 SV=1 15 220 3.0E-38
sp|P40693|RLP7_YEAST Ribosome biogenesis protein RLP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RLP7 PE=1 SV=1 15 227 6.0E-37
sp|Q6FS36|RLP7_CANGA Ribosome biogenesis protein RLP7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RLP7 PE=3 SV=1 15 220 1.0E-36
sp|Q8SS93|RL7_ENCCU 60S ribosomal protein L7 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPL7 PE=3 SV=1 22 248 2.0E-36
sp|P32101|RLP7_CYBJA Ribosome biogenesis protein RLP7 (Fragment) OS=Cyberlindnera jadinii GN=RLP7 PE=3 SV=1 63 222 4.0E-28
sp|Q9HH78|RL30_PYRFU 50S ribosomal protein L30P OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl30p PE=1 SV=1 92 248 4.0E-14
sp|Q9V1V6|RL30_PYRAB 50S ribosomal protein L30P OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl30p PE=3 SV=1 92 248 4.0E-14
sp|O59440|RL30_PYRHO 50S ribosomal protein L30P OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl30p PE=3 SV=1 92 248 2.0E-13
sp|A8ABZ9|RL30_IGNH4 50S ribosomal protein L30P OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl30p PE=3 SV=1 88 248 2.0E-10
sp|A2BME0|RL30_HYPBU 50S ribosomal protein L30P OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl30p PE=3 SV=2 72 248 3.0E-10
sp|A3DNC8|RL30_STAMF 50S ribosomal protein L30P OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl30p PE=3 SV=1 89 248 4.0E-10
sp|Q5JJG9|RL30_THEKO 50S ribosomal protein L30P OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl30p PE=3 SV=1 106 248 7.0E-10
sp|Q9YF96|RL30_AERPE 50S ribosomal protein L30P OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl30p PE=3 SV=2 89 248 9.0E-10
sp|Q8ZXN8|RL30_PYRAE 50S ribosomal protein L30P OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl30p PE=3 SV=1 92 248 1.0E-09
sp|Q975K1|RL30_SULTO 50S ribosomal protein L30P OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl30p PE=3 SV=1 87 248 2.0E-09
sp|A1RU38|RL30_PYRIL 50S ribosomal protein L30P OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rpl30p PE=3 SV=1 92 248 3.0E-09
sp|A3MU87|RL30_PYRCJ 50S ribosomal protein L30P OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rpl30p PE=3 SV=1 92 248 5.0E-09
sp|A4YCY7|RL30_METS5 50S ribosomal protein L30P OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpl30p PE=3 SV=1 90 248 1.0E-08
sp|B1L787|RL30_KORCO 50S ribosomal protein L30P OS=Korarchaeum cryptofilum (strain OPF8) GN=rpl30p PE=3 SV=1 86 248 1.0E-08
sp|O26132|RL30_METTH 50S ribosomal protein L30P OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl30p PE=3 SV=1 89 248 2.0E-08
sp|A1RWR5|RL30_THEPD 50S ribosomal protein L30P OS=Thermofilum pendens (strain Hrk 5) GN=rpl30p PE=3 SV=1 89 248 2.0E-08
sp|Q2FSG4|RL30_METHJ 50S ribosomal protein L30P OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl30p PE=3 SV=1 92 248 2.0E-08
sp|B8D5U9|RL30_DESK1 50S ribosomal protein L30P OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rpl30p PE=3 SV=1 87 248 3.0E-08
sp|Q2NFX8|RL30_METST 50S ribosomal protein L30P OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl30p PE=3 SV=1 92 248 8.0E-08
sp|Q6L1A6|RL30_PICTO 50S ribosomal protein L30P OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl30p PE=3 SV=1 89 248 8.0E-08
sp|C4KHH7|RL30_SULIK 50S ribosomal protein L30P OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpl30p PE=3 SV=1 87 248 1.0E-07
sp|C3N5U8|RL30_SULIA 50S ribosomal protein L30P OS=Sulfolobus islandicus (strain M.16.27) GN=rpl30p PE=3 SV=1 87 248 1.0E-07
sp|C3MQ80|RL30_SULIL 50S ribosomal protein L30P OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpl30p PE=3 SV=1 87 248 1.0E-07
sp|C3MVJ9|RL30_SULIM 50S ribosomal protein L30P OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpl30p PE=3 SV=1 87 248 1.0E-07
sp|C3NH88|RL30_SULIN 50S ribosomal protein L30P OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpl30p PE=3 SV=1 87 248 1.0E-07
sp|Q12ZT0|RL30_METBU 50S ribosomal protein L30P OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl30p PE=3 SV=1 89 248 1.0E-07
sp|C3NEG4|RL30_SULIY 50S ribosomal protein L30P OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpl30p PE=3 SV=1 87 248 3.0E-07
sp|O05642|RL30_SULAC 50S ribosomal protein L30P OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl30p PE=3 SV=1 88 248 4.0E-07
sp|A0B9U9|RL30_METTP 50S ribosomal protein L30P OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rpl30p PE=3 SV=1 92 248 8.0E-07
sp|Q9UX86|RL30_SULSO 50S ribosomal protein L30P OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl30p PE=3 SV=1 87 248 1.0E-06
sp|A4WHQ9|RL30_PYRAR 50S ribosomal protein L30P OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rpl30p PE=3 SV=1 85 248 2.0E-06
sp|Q8PV29|RL30_METMA 50S ribosomal protein L30P OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl30p PE=3 SV=1 92 248 7.0E-06
sp|A8MDN0|RL30_CALMQ 50S ribosomal protein L30P OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rpl30p PE=3 SV=1 89 248 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6596
MGATTVPTNDQILVPETLLKKRKSQEKARAERSAAVEKKKAANKEKRGVIFKRAEKYVKEYRDAEREKIRLARVA
KKEDSAYIPAEAKLIFVVRIKGINKMPPKPRKTLQLLRLLQINNGVFIKVTKATTEMLKIVEPWIAYGYPNLKSI
KELIYKRGYGKVDKQRIALTDNSIIEESLGKYGIVCMEDLIHEIYTVGPNFKQASNFLWPFKLSNPTGGFRPRKF
KHFIEGGDLGNREEAINALIRQMN*
Coding >Hirsu2|6596
ATGGGTGCCACAACCGTCCCTACCAACGACCAGATCCTGGTTCCCGAGACGCTTCTCAAGAAGCGGAAGAGCCAG
GAGAAGGCTCGCGCTGAGCGCAGTGCCGCTGTCGAGAAGAAGAAGGCTGCCAACAAGGAGAAGCGTGGTGTCATC
TTCAAGCGTGCCGAGAAGTACGTCAAGGAGTACCGCGATGCGGAGCGCGAGAAGATCCGTCTGGCCCGTGTCGCC
AAGAAGGAGGACTCTGCCTACATCCCTGCCGAGGCCAAGCTGATCTTCGTCGTCCGCATCAAGGGTATCAACAAG
ATGCCTCCCAAGCCTCGCAAGACCCTCCAACTGCTTCGTCTTCTCCAGATCAACAACGGCGTCTTCATCAAGGTC
ACCAAGGCCACCACGGAGATGCTGAAGATTGTTGAGCCTTGGATTGCCTATGGTTACCCCAACCTGAAGTCGATC
AAGGAGCTCATTTACAAGCGTGGATATGGCAAGGTCGACAAGCAGCGCATCGCCCTGACCGACAACTCCATCATT
GAGGAGAGCCTGGGCAAGTACGGCATTGTCTGCATGGAAGACCTGATCCATGAGATCTACACCGTCGGCCCCAAC
TTCAAGCAGGCCTCCAACTTCCTGTGGCCCTTCAAGCTGAGCAACCCCACTGGCGGCTTCCGTCCCCGGAAGTTC
AAGCACTTCATTGAGGGCGGTGACCTGGGCAACCGCGAGGAGGCCATCAACGCCCTGATCCGGCAAATGAACTAG
Transcript >Hirsu2|6596
ATGGGTGCCACAACCGTCCCTACCAACGACCAGATCCTGGTTCCCGAGACGCTTCTCAAGAAGCGGAAGAGCCAG
GAGAAGGCTCGCGCTGAGCGCAGTGCCGCTGTCGAGAAGAAGAAGGCTGCCAACAAGGAGAAGCGTGGTGTCATC
TTCAAGCGTGCCGAGAAGTACGTCAAGGAGTACCGCGATGCGGAGCGCGAGAAGATCCGTCTGGCCCGTGTCGCC
AAGAAGGAGGACTCTGCCTACATCCCTGCCGAGGCCAAGCTGATCTTCGTCGTCCGCATCAAGGGTATCAACAAG
ATGCCTCCCAAGCCTCGCAAGACCCTCCAACTGCTTCGTCTTCTCCAGATCAACAACGGCGTCTTCATCAAGGTC
ACCAAGGCCACCACGGAGATGCTGAAGATTGTTGAGCCTTGGATTGCCTATGGTTACCCCAACCTGAAGTCGATC
AAGGAGCTCATTTACAAGCGTGGATATGGCAAGGTCGACAAGCAGCGCATCGCCCTGACCGACAACTCCATCATT
GAGGAGAGCCTGGGCAAGTACGGCATTGTCTGCATGGAAGACCTGATCCATGAGATCTACACCGTCGGCCCCAAC
TTCAAGCAGGCCTCCAACTTCCTGTGGCCCTTCAAGCTGAGCAACCCCACTGGCGGCTTCCGTCCCCGGAAGTTC
AAGCACTTCATTGAGGGCGGTGACCTGGGCAACCGCGAGGAGGCCATCAACGCCCTGATCCGGCAAATGAACTAG
Gene >Hirsu2|6596
ATGGGTGCCACGTATGTCCCTCCTCTCTGAACATGCGACTCCGGGCAGTGGCGCCTGGTCCCGAGACTTTGACAG
ATTGTTCGCGGTCCTCTCGTTGGGCAGACGACCGAAAGGTCGATTCACCTGCTCGATCTCTCCCGAGTGGCCTCC
CTTCGTCGCACAGACTCATCCCACGGTTTGGCGGCGGAGAGATGGCGCTGGGGGTGTTGGGGATGACGATGCACA
TCGACTCCCTCAAATTCATTGTCGCTTTCGGCGGCTGCAGCGGTTTAAATTGTCTCGTTGCAAATGCTGGCGACT
ACACTCTCCCGGATGGCATCCATCGGGGGTTGTTGTCGGATGAGTGGCAAAGAGAAGAATGACCTCAATCGTGAT
TGAGGATCACGATTCTCTCTCTCACCGATCAAATCCATCTCGAGTCAGCCAAAGCAGAGAATGTCGCGCTACAGC
TGCAATTCTCGCACCGGCGCTCTGTTCCATACCTCGGTATGCTGGACCCGTGCTAATCTGAGATGCGCCTGCAGA
ACCGTCCCTACCAACGACCAGATCCTGGTTCCCGAGACGCTTCTCAAGAAGCGGAAGAGCCAGGAGAAGGCTCGC
GCTGAGCGCAGTGCCGCTGTCGAGAAGAAGAAGGCTGTGAGTTTATTCCCAAGTTCCACCCTCCCGGCCGAATGA
TGCACAACGTACCTCTCGACTAGACCTCGTTGTCGATGCTGTTGATAATATACCTTCTTTCGGGTCTGACAAGCC
CACTTCACCCATATCATGTCAAACACCCATTACTACTGCAATTGGTCGCTGACAGGCTCGATAGGCCAACAAGGA
GAAGCGTGGTGTCATCTTCAAGCGTGCCGAGAAGTACGTCAAGGAGTACCGCGATGCGGAGCGCGAGAAGATCCG
TCTGGCCCGTGTCGCCAAGAAGGAGGACTCTGCCTACATCCCTGCCGAGGCCAAGCTGATCTTCGTCGTCCGCAT
CAAGGGGTGAGACTACCTGTTTGTGCGCTCGATCTCATCTACAGGGACTGACATTGCTGCAGTATCAACAAGATG
CCTCCCAAGCCTCGCAAGACCCTCCAACTGCTTCGTCTTCTCCAGATCAACAACGGCGTCTTCATCAAGGTCACC
AAGGCCACCACGGAGATGCTGAAGATTGTTGAGCCTTGGATTGCCTATGGTTACCCCAACCTGAAGTCGATCAAG
GAGCTCATTTACAAGCGTGGATATGGCAAGGTCGACAAGCAGCGCATCGCCCTGACCGACAACTCCATCATTGAG
GAGAGCCTGGGCAAGTACGGCATTGTCTGCATGGAAGACCTGATCCATGAGATCTACACCGTCGGCCCCAACTTC
AAGCAGGCCTCCAACTTCCTGTGGCCCTTCAAGCTGAGCAACCCCACTGGCGGCTTCCGTCCCCGGAAGTTCAAG
CACTTCATTGAGGGCGGTGACCTGGGCAACCGCGAGGAGGCCATCAACGCCCTGATCCGGCAAATGAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail