Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6593
Gene name
LocationContig_342:12868..14026
Strand+
Gene length (bp)1158
Transcript length (bp)897
Coding sequence length (bp)897
Protein length (aa) 299

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.3E-36 6 183
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.1E-29 15 182
PF08659 KR KR domain 3.9E-06 6 162
PF08643 DUF1776 Fungal family of unknown function (DUF1776) 2.8E-04 98 175

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 1 254 1.0E-50
sp|P40471|AYR1_YEAST NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AYR1 PE=1 SV=1 4 296 2.0E-33
sp|P0AFP4|YBBO_ECOLI Uncharacterized oxidoreductase YbbO OS=Escherichia coli (strain K12) GN=ybbO PE=3 SV=1 4 186 7.0E-22
sp|P0AFP5|YBBO_ECOL6 Uncharacterized oxidoreductase YbbO OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybbO PE=3 SV=1 4 186 7.0E-22
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 7 184 6.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 1 254 1.0E-50
sp|P40471|AYR1_YEAST NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AYR1 PE=1 SV=1 4 296 2.0E-33
sp|P0AFP4|YBBO_ECOLI Uncharacterized oxidoreductase YbbO OS=Escherichia coli (strain K12) GN=ybbO PE=3 SV=1 4 186 7.0E-22
sp|P0AFP5|YBBO_ECOL6 Uncharacterized oxidoreductase YbbO OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybbO PE=3 SV=1 4 186 7.0E-22
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 7 184 6.0E-20
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 3 198 9.0E-20
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 7 184 9.0E-20
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 3 198 1.0E-19
sp|O16881|DHS16_CAEEL 3 beta-hydroxysteroid dehydrogenase dhs-16 OS=Caenorhabditis elegans GN=dhs-16 PE=2 SV=1 7 221 3.0E-19
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 7 185 5.0E-19
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 6 182 9.0E-18
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 3 223 1.0E-17
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 7 198 2.0E-17
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 3 198 4.0E-17
sp|P29147|BDH_RAT D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Bdh1 PE=1 SV=2 7 202 7.0E-17
sp|O54753|H17B6_RAT 17-beta-hydroxysteroid dehydrogenase type 6 OS=Rattus norvegicus GN=Hsd17b6 PE=1 SV=2 7 208 9.0E-17
sp|P14061|DHB1_HUMAN Estradiol 17-beta-dehydrogenase 1 OS=Homo sapiens GN=HSD17B1 PE=1 SV=3 4 182 9.0E-17
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 3 198 1.0E-16
sp|Q80XN0|BDH_MOUSE D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Mus musculus GN=Bdh1 PE=1 SV=2 7 202 1.0E-16
sp|Q9R092|H17B6_MOUSE 17-beta-hydroxysteroid dehydrogenase type 6 OS=Mus musculus GN=Hsd17b6 PE=1 SV=1 7 208 1.0E-16
sp|Q9STY7|HSD3_ARATH 11-beta-hydroxysteroid dehydrogenase-like 3 OS=Arabidopsis thaliana GN=HSD3 PE=3 SV=1 4 182 1.0E-16
sp|P51656|DHB1_MOUSE Estradiol 17-beta-dehydrogenase 1 OS=Mus musculus GN=Hsd17b1 PE=2 SV=1 5 186 1.0E-16
sp|O74628|YQ53_SCHPO Uncharacterized oxidoreductase C162.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.03 PE=3 SV=1 5 183 2.0E-16
sp|P51657|DHB1_RAT Estradiol 17-beta-dehydrogenase 1 OS=Rattus norvegicus GN=Hsd17b1 PE=1 SV=1 5 186 3.0E-16
sp|Q1WNP0|DHB1_PANTR Estradiol 17-beta-dehydrogenase 1 OS=Pan troglodytes GN=HSD17B1 PE=3 SV=3 4 182 4.0E-16
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 8 172 6.0E-16
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 8 172 6.0E-16
sp|Q02337|BDH_BOVIN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=BDH1 PE=1 SV=2 7 209 1.0E-15
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 8 172 1.0E-15
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 8 172 1.0E-15
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 8 172 1.0E-15
sp|P55434|Y4EK_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4eK OS=Rhizobium sp. (strain NGR234) GN=NGR_a03840 PE=3 SV=1 1 185 2.0E-15
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 8 172 2.0E-15
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 8 172 2.0E-15
sp|Q9KWN1|SDH_RHIRD Serine 3-dehydrogenase OS=Rhizobium radiobacter GN=sdh PE=1 SV=1 6 172 3.0E-15
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 3 187 4.0E-15
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 3 187 4.0E-15
sp|Q3T001|H17B6_BOVIN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Bos taurus GN=HSD17B6 PE=2 SV=1 7 191 4.0E-15
sp|Q49117|Y182_METEA Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 8 199 4.0E-15
sp|P39831|YDFG_ECOLI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli (strain K12) GN=ydfG PE=1 SV=2 7 172 4.0E-15
sp|Q02338|BDH_HUMAN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Homo sapiens GN=BDH1 PE=1 SV=3 7 209 6.0E-15
sp|Q9N126|RDH8_BOVIN Retinol dehydrogenase 8 OS=Bos taurus GN=RDH8 PE=1 SV=1 6 187 6.0E-15
sp|Q8X505|YDFG_ECO57 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O157:H7 GN=ydfG PE=3 SV=1 7 172 6.0E-15
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 8 172 6.0E-15
sp|O05730|VDLC_HELPY Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=vdlC PE=3 SV=2 2 183 8.0E-15
sp|Q8U8I2|SDH_AGRFC Serine 3-dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=sdh PE=3 SV=1 6 172 1.0E-14
sp|Q59787|DHSO_RHOSH Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1 6 187 1.0E-14
sp|Q9NYR8|RDH8_HUMAN Retinol dehydrogenase 8 OS=Homo sapiens GN=RDH8 PE=1 SV=1 6 187 1.0E-14
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 6 218 2.0E-14
sp|P9WGR5|Y484_MYCTU Uncharacterized oxidoreductase Rv0484c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0484c PE=1 SV=1 3 187 2.0E-14
sp|P9WGR4|Y484_MYCTO Uncharacterized oxidoreductase MT0502 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0502 PE=3 SV=1 3 187 2.0E-14
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 3 185 3.0E-14
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 8 186 7.0E-14
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 5 184 1.0E-13
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 5 184 1.0E-13
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 5 184 1.0E-13
sp|Q8FHD2|YDFG_ECOL6 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ydfG PE=3 SV=2 7 172 1.0E-13
sp|Q83RE8|YDFG_SHIFL NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Shigella flexneri GN=ydfG PE=3 SV=2 7 172 1.0E-13
sp|P69936|YDFG_SALTY NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ydfG PE=3 SV=1 7 172 2.0E-13
sp|P69935|YDFG_SALTI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhi GN=ydfG PE=3 SV=1 7 172 2.0E-13
sp|Q9ZKW1|VDLC_HELPJ Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=vdlC PE=3 SV=1 8 183 2.0E-13
sp|O14756|H17B6_HUMAN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Homo sapiens GN=HSD17B6 PE=1 SV=1 7 182 3.0E-13
sp|P51658|DHB2_MOUSE Estradiol 17-beta-dehydrogenase 2 OS=Mus musculus GN=Hsd17b2 PE=1 SV=2 4 184 3.0E-13
sp|A6NNS2|DRS7C_HUMAN Dehydrogenase/reductase SDR family member 7C OS=Homo sapiens GN=DHRS7C PE=2 SV=3 4 185 3.0E-13
sp|A9UM79|DRS7C_XENTR Dehydrogenase/reductase SDR family member 7C OS=Xenopus tropicalis GN=dhrs7c PE=2 SV=1 1 188 3.0E-13
sp|Q0U3N7|MKAR_PHANO Very-long-chain 3-oxoacyl-CoA reductase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_13627 PE=3 SV=1 3 208 5.0E-13
sp|Q1RMJ5|DRS7C_BOVIN Dehydrogenase/reductase SDR family member 7C OS=Bos taurus GN=DHRS7C PE=2 SV=2 4 186 5.0E-13
sp|Q9LUF2|HSD4B_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4B OS=Arabidopsis thaliana GN=HSD7 PE=2 SV=2 6 182 5.0E-13
sp|P0DKC7|HSD4A_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4A OS=Arabidopsis thaliana GN=HSD4 PE=2 SV=1 6 182 5.0E-13
sp|P39482|DHG1_BACME Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 7 172 7.0E-13
sp|P39483|DHG2_BACME Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1 3 172 7.0E-13
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 7 187 7.0E-13
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 7 187 7.0E-13
sp|A4IGM4|DHI1L_XENTR Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Xenopus tropicalis GN=hsd11b1l PE=2 SV=1 4 183 9.0E-13
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 6 254 1.0E-12
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 6 254 1.0E-12
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 7 172 1.0E-12
sp|Q1JP75|DCXR_BOVIN L-xylulose reductase OS=Bos taurus GN=DCXR PE=2 SV=1 8 172 1.0E-12
sp|A5DND6|MKAR_PICGU Very-long-chain 3-oxoacyl-CoA reductase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_04787 PE=3 SV=1 8 182 2.0E-12
sp|Q9P324|YI78_SCHPO Uncharacterized oxidoreductase C977.08/C1348.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.08 PE=3 SV=1 53 174 2.0E-12
sp|Q1DNC5|MKAR_COCIM Very-long-chain 3-oxoacyl-CoA reductase OS=Coccidioides immitis (strain RS) GN=CIMG_08188 PE=3 SV=2 8 182 2.0E-12
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 8 172 4.0E-12
sp|Q8HYR6|DHRS9_BOVIN Dehydrogenase/reductase SDR family member 9 OS=Bos taurus GN=DHRS9 PE=2 SV=1 7 191 4.0E-12
sp|Q62730|DHB2_RAT Estradiol 17-beta-dehydrogenase 2 OS=Rattus norvegicus GN=Hsd17b2 PE=2 SV=1 4 184 4.0E-12
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 6 182 5.0E-12
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 3 210 7.0E-12
sp|A8E5C5|DS7CA_DANRE Dehydrogenase/reductase SDR family member 7C-A OS=Danio rerio GN=dhrs7ca PE=2 SV=1 3 191 7.0E-12
sp|Q8CHS7|DRS7C_MOUSE Dehydrogenase/reductase SDR family member 7C OS=Mus musculus GN=Dhrs7c PE=1 SV=3 4 172 8.0E-12
sp|Q27979|RDH1_BOVIN 11-cis retinol dehydrogenase OS=Bos taurus GN=RDH5 PE=1 SV=1 7 186 9.0E-12
sp|A5E0R1|MKAR_LODEL Very-long-chain 3-oxoacyl-CoA reductase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_03198 PE=3 SV=1 8 182 9.0E-12
sp|P39484|DHG3_BACME Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1 3 172 1.0E-11
sp|Q5BL28|DS7CB_DANRE Dehydrogenase/reductase SDR family member 7C-B OS=Danio rerio GN=dhrs7cb PE=2 SV=1 3 193 1.0E-11
sp|O75452|RDH16_HUMAN Retinol dehydrogenase 16 OS=Homo sapiens GN=RDH16 PE=1 SV=2 3 184 1.0E-11
sp|P07999|DHGB_BACME Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 7 172 2.0E-11
sp|P10528|DHGA_BACME Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1 3 172 2.0E-11
sp|Q5XG41|DH12A_XENLA Very-long-chain 3-oxoacyl-CoA reductase-A OS=Xenopus laevis GN=hsd17b12-a PE=2 SV=1 8 172 2.0E-11
sp|P39485|DHG4_BACME Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=1 SV=1 3 172 2.0E-11
sp|Q9BPW9|DHRS9_HUMAN Dehydrogenase/reductase SDR family member 9 OS=Homo sapiens GN=DHRS9 PE=1 SV=1 7 186 2.0E-11
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 6 180 3.0E-11
sp|Q53GQ0|DHB12_HUMAN Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens GN=HSD17B12 PE=1 SV=2 8 172 3.0E-11
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 7 187 3.0E-11
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 8 235 3.0E-11
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 8 235 3.0E-11
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 4 183 4.0E-11
sp|Q5ZJZ5|BDH_CHICK D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Gallus gallus GN=BDH1 PE=2 SV=1 43 213 4.0E-11
sp|O70503|DHB12_MOUSE Very-long-chain 3-oxoacyl-CoA reductase OS=Mus musculus GN=Hsd17b12 PE=1 SV=1 16 172 4.0E-11
sp|Q58NB6|DHRS9_MOUSE Dehydrogenase/reductase SDR family member 9 OS=Mus musculus GN=Dhrs9 PE=2 SV=2 7 191 5.0E-11
sp|Q7Z4W1|DCXR_HUMAN L-xylulose reductase OS=Homo sapiens GN=DCXR PE=1 SV=2 7 172 5.0E-11
sp|P37440|UCPA_ECOLI Oxidoreductase UcpA OS=Escherichia coli (strain K12) GN=ucpA PE=3 SV=3 6 231 5.0E-11
sp|P80869|DHG2_BACSU Glucose 1-dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=ycdF PE=1 SV=2 6 180 5.0E-11
sp|O57314|DHB12_ANAPL Very-long-chain 3-oxoacyl-CoA reductase OS=Anas platyrhynchos GN=HSD17B12 PE=2 SV=1 8 208 6.0E-11
sp|Q91XV4|DCXR_MESAU L-xylulose reductase OS=Mesocricetus auratus GN=DCXR PE=1 SV=1 8 172 6.0E-11
sp|Q6P7R8|DHB12_RAT Very-long-chain 3-oxoacyl-CoA reductase OS=Rattus norvegicus GN=Hsd17b12 PE=2 SV=1 16 172 7.0E-11
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 6 183 7.0E-11
sp|Q8XBJ4|UCPA_ECO57 Oxidoreductase UcpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2 6 254 7.0E-11
sp|Q8AVY8|DH12B_XENLA Very-long-chain 3-oxoacyl-CoA reductase-B OS=Xenopus laevis GN=hsd17b12-b PE=2 SV=1 8 172 9.0E-11
sp|Q8VD48|DHRS9_RAT Dehydrogenase/reductase SDR family member 9 OS=Rattus norvegicus GN=Dhrs9 PE=2 SV=1 7 172 9.0E-11
sp|Q28IU1|DHB12_XENTR Very-long-chain 3-oxoacyl-CoA reductase OS=Xenopus tropicalis GN=hsd17b12 PE=2 SV=1 8 172 9.0E-11
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 8 184 1.0E-10
sp|O55240|RDH1_MOUSE 11-cis retinol dehydrogenase OS=Mus musculus GN=Rdh5 PE=1 SV=1 7 186 1.0E-10
sp|A6RBW9|MKAR_AJECN Very-long-chain 3-oxoacyl-CoA reductase OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_07127 PE=3 SV=1 8 184 1.0E-10
sp|Q8JIS3|DER_CHICK D-erythrulose reductase OS=Gallus gallus GN=DER PE=1 SV=1 8 172 1.0E-10
sp|Q7RYE5|MKAR_NEUCR Very-long-chain 3-oxoacyl-CoA reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU11297 PE=3 SV=1 2 222 1.0E-10
sp|Q5E9H7|DHB12_BOVIN Very-long-chain 3-oxoacyl-CoA reductase OS=Bos taurus GN=HSD17B12 PE=2 SV=1 16 172 1.0E-10
sp|P39640|BACC_BACSU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis (strain 168) GN=bacC PE=1 SV=2 6 203 1.0E-10
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 8 182 1.0E-10
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 8 182 1.0E-10
sp|Q6P7J1|DHI1A_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein A OS=Xenopus laevis GN=hsd11b1l-a PE=2 SV=1 3 209 1.0E-10
sp|Q92781|RDH1_HUMAN 11-cis retinol dehydrogenase OS=Homo sapiens GN=RDH5 PE=1 SV=1 7 244 2.0E-10
sp|O32291|YXNA_BACSU Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 7 176 2.0E-10
sp|B2WMJ3|MKAR_PYRTR Very-long-chain 3-oxoacyl-CoA reductase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_11203 PE=3 SV=2 3 184 2.0E-10
sp|P50170|RDH2_RAT Retinol dehydrogenase 2 OS=Rattus norvegicus GN=Rdh2 PE=1 SV=1 7 191 2.0E-10
sp|P37079|SORD_KLEPN Sorbitol-6-phosphate 2-dehydrogenase OS=Klebsiella pneumoniae GN=sorD PE=3 SV=1 4 173 2.0E-10
sp|Q4L8Y1|Y0585_STAHJ Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 8 182 2.0E-10
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 8 184 2.0E-10
sp|P51976|DHI2_RABIT Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Oryctolagus cuniculus GN=HSD11B2 PE=2 SV=1 7 183 2.0E-10
sp|D3U1D9|ISFD_KLEOX Sulfoacetaldehyde reductase OS=Klebsiella oxytoca GN=isfD PE=1 SV=1 1 172 2.0E-10
sp|Q4R5G7|DHB12_MACFA Very-long-chain 3-oxoacyl-CoA reductase OS=Macaca fascicularis GN=HSD17B12 PE=2 SV=1 8 172 2.0E-10
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 6 184 4.0E-10
sp|P0CR34|MKAR_CRYNJ Very-long-chain 3-oxoacyl-CoA reductase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNI00690 PE=3 SV=1 2 172 4.0E-10
sp|P0CR35|MKAR_CRYNB Very-long-chain 3-oxoacyl-CoA reductase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBH0660 PE=3 SV=1 2 172 4.0E-10
sp|Q8KWT4|BACC_BACIU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis GN=bacC PE=1 SV=1 6 203 4.0E-10
sp|Q937L4|CPNA_COMTE Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1 7 191 4.0E-10
sp|Q8GAV9|CPNA_COMS9 Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1 7 191 4.0E-10
sp|P51661|DHI2_MOUSE Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Mus musculus GN=Hsd11b2 PE=1 SV=2 7 182 4.0E-10
sp|Q8K3P0|DR9C7_MOUSE Short-chain dehydrogenase/reductase family 9C member 7 OS=Mus musculus GN=Sdr9c7 PE=2 SV=1 7 215 4.0E-10
sp|O88451|RDH7_MOUSE Retinol dehydrogenase 7 OS=Mus musculus GN=Rdh7 PE=1 SV=1 7 184 5.0E-10
sp|Q9CXR1|DHRS7_MOUSE Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 6 191 5.0E-10
sp|A7F8T1|MKAR_SCLS1 Very-long-chain 3-oxoacyl-CoA reductase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_14012 PE=3 SV=1 2 177 6.0E-10
sp|P05406|FIXR_BRADU Protein FixR OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixR PE=3 SV=2 7 182 6.0E-10
sp|B2B3L4|MKAR_PODAN Very-long-chain 3-oxoacyl-CoA reductase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_6_6580 PE=3 SV=2 2 177 6.0E-10
sp|P45200|Y1430_HAEIN Probable NADP-dependent dehydrogenase HI_1430 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1430 PE=3 SV=1 3 220 6.0E-10
sp|Q5HKG6|BUTA_STAEQ Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=butA PE=3 SV=1 6 186 6.0E-10
sp|Q8KWS9|BACC_BACAM Dihydroanticapsin 7-dehydrogenase OS=Bacillus amyloliquefaciens GN=bacC PE=1 SV=1 6 154 7.0E-10
sp|Q1QU27|ISFD2_CHRSD Sulfoacetaldehyde reductase 2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD2 PE=1 SV=1 7 172 7.0E-10
sp|Q91X52|DCXR_MOUSE L-xylulose reductase OS=Mus musculus GN=Dcxr PE=1 SV=2 8 172 8.0E-10
sp|Q68VY7|FABG_RICTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fabG PE=3 SV=1 6 235 9.0E-10
sp|Q2H1V7|MKAR_CHAGB Very-long-chain 3-oxoacyl-CoA reductase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_04239 PE=3 SV=1 2 177 9.0E-10
sp|Q12634|T4HR_MAGO7 Tetrahydroxynaphthalene reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_02252 PE=1 SV=2 8 185 1.0E-09
sp|Q53882|DNRE_STRS5 Aklaviketone reductase DauE OS=Streptomyces sp. (strain C5) GN=dauE PE=1 SV=1 4 182 1.0E-09
sp|P12310|DHG_BACSU Glucose 1-dehydrogenase OS=Bacillus subtilis (strain 168) GN=gdh PE=2 SV=2 3 184 1.0E-09
sp|A1C6J8|MKAR_ASPCL Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_070510 PE=3 SV=1 8 172 1.0E-09
sp|Q8P3K4|FUCDH_XANCP 2-keto-3-deoxy-L-fuconate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC4067 PE=1 SV=1 16 182 1.0E-09
sp|P50165|TRNH_DATST Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1 3 172 2.0E-09
sp|Q8CQD2|BUTA_STAES Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=butA PE=3 SV=1 6 186 2.0E-09
sp|A6SG70|MKAR_BOTFB Very-long-chain 3-oxoacyl-CoA reductase OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_11561 PE=3 SV=1 2 177 2.0E-09
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 6 235 2.0E-09
sp|Q7SYS6|DHI1B_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein B OS=Xenopus laevis GN=hsd11b1l-b PE=2 SV=1 3 209 2.0E-09
sp|P0DKI3|TRNH1_ARATH Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1 3 171 3.0E-09
sp|A8N6B4|MKAR_COPC7 Very-long-chain 3-oxoacyl-CoA reductase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_02019 PE=3 SV=1 8 172 3.0E-09
sp|P55006|RDH7_RAT Retinol dehydrogenase 7 OS=Rattus norvegicus GN=Rdh7 PE=2 SV=1 7 203 3.0E-09
sp|Q9FYL6|KCR2_ARATH Very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470 OS=Arabidopsis thaliana GN=KCR2 PE=2 SV=1 8 240 3.0E-09
sp|A1DH66|MKAR_NEOFI Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_086780 PE=3 SV=1 8 172 3.0E-09
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 7 172 3.0E-09
sp|Q0CY11|MKAR_ASPTN Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_01423 PE=3 SV=1 8 172 3.0E-09
sp|Q4X117|MKAR_ASPFU Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G11540 PE=3 SV=1 8 172 4.0E-09
sp|B0XSI3|MKAR_ASPFC Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_027290 PE=3 SV=1 8 172 4.0E-09
sp|Q5FPE5|GMDH_GLUOX Glucose 1-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=GOX2015 PE=1 SV=1 7 180 4.0E-09
sp|Q920N9|DCXR_CAVPO L-xylulose reductase OS=Cavia porcellus GN=DCXR PE=2 SV=1 8 172 7.0E-09
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 8 192 7.0E-09
sp|Q5B0R9|MKAR_EMENI Very-long-chain 3-oxoacyl-CoA reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5861 PE=3 SV=1 8 172 7.0E-09
sp|P23102|XYLL_PSEPU 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Pseudomonas putida GN=xylL PE=3 SV=1 8 182 7.0E-09
sp|C1C4R8|BDH2_LITCT 3-hydroxybutyrate dehydrogenase type 2 OS=Lithobates catesbeiana GN=bdh2 PE=2 SV=1 7 239 7.0E-09
sp|Q6P3L6|DH12A_DANRE Very-long-chain 3-oxoacyl-CoA reductase-A OS=Danio rerio GN=hsd17b12a PE=2 SV=1 8 172 8.0E-09
sp|Q920P0|DCXR_RAT L-xylulose reductase OS=Rattus norvegicus GN=Dcxr PE=1 SV=1 8 172 9.0E-09
sp|A7DY56|TRN1_COCOF Tropinone reductase OS=Cochlearia officinalis GN=TR PE=1 SV=1 6 228 9.0E-09
sp|Q6QLL4|DHI1_CAVPO Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Cavia porcellus GN=HSD11B1 PE=1 SV=3 1 235 1.0E-08
sp|P41177|DHKR_STRCM Monensin polyketide synthase putative ketoacyl reductase OS=Streptomyces cinnamonensis PE=3 SV=1 8 232 1.0E-08
sp|P50169|RDH3_RAT Retinol dehydrogenase 3 OS=Rattus norvegicus GN=Rdh3 PE=1 SV=1 7 186 1.0E-08
sp|P80365|DHI2_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Homo sapiens GN=HSD11B2 PE=1 SV=2 7 183 1.0E-08
sp|P50163|TRN2_DATST Tropinone reductase 2 OS=Datura stramonium GN=TR2 PE=1 SV=1 6 172 1.0E-08
sp|Q5ZJG8|HSDL1_CHICK Hydroxysteroid dehydrogenase-like protein 1 OS=Gallus gallus GN=HSDL1 PE=2 SV=1 8 251 1.0E-08
sp|Q9T0G0|HSD5_ARATH 11-beta-hydroxysteroid dehydrogenase-like 5 OS=Arabidopsis thaliana GN=HSD5 PE=2 SV=1 6 165 1.0E-08
sp|A2QCH3|MKAR_ASPNC Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g03570 PE=3 SV=1 8 172 1.0E-08
sp|P07772|BEND_ACIAD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benD PE=3 SV=2 6 193 2.0E-08
sp|P37059|DHB2_HUMAN Estradiol 17-beta-dehydrogenase 2 OS=Homo sapiens GN=HSD17B2 PE=1 SV=1 4 184 2.0E-08
sp|P50199|GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=gno PE=1 SV=1 8 154 2.0E-08
sp|Q3KPT7|BDH2_XENLA 3-hydroxybutyrate dehydrogenase type 2 OS=Xenopus laevis GN=bdh2 PE=2 SV=1 7 239 2.0E-08
sp|A8Q1U2|MKAR_MALGO Very-long-chain 3-oxoacyl-CoA reductase OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MGL_1839 PE=3 SV=1 8 242 2.0E-08
sp|Q60V51|LE767_CAEBR Very-long-chain 3-oxooacyl-coA reductase let-767 OS=Caenorhabditis briggsae GN=let-767 PE=3 SV=1 8 172 2.0E-08
sp|Q8T197|DHRS7_DICDI Dehydrogenase/reductase SDR family protein 7-like OS=Dictyostelium discoideum GN=DDB_G0274201 PE=3 SV=1 3 217 2.0E-08
sp|P50233|DHI2_RAT Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Rattus norvegicus GN=Hsd11b2 PE=1 SV=1 7 183 3.0E-08
sp|Q29529|CBR2_PIG Carbonyl reductase [NADPH] 2 OS=Sus scrofa GN=CBR2 PE=1 SV=1 8 172 3.0E-08
sp|Q75A60|MKAR_ASHGO Very-long-chain 3-oxoacyl-CoA reductase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ADR059C PE=3 SV=2 8 182 3.0E-08
sp|Q6BIG0|MKAR_DEBHA Very-long-chain 3-oxoacyl-CoA reductase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G10780g PE=3 SV=1 8 182 3.0E-08
sp|A4IFM3|DR9C7_BOVIN Short-chain dehydrogenase/reductase family 9C member 7 OS=Bos taurus GN=SDR9C7 PE=2 SV=1 7 228 3.0E-08
sp|B0D8R3|MKAR_LACBS Very-long-chain 3-oxoacyl-CoA reductase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_192627 PE=3 SV=1 8 172 3.0E-08
sp|A4QTE3|MKAR_MAGO7 Very-long-chain 3-oxoacyl-CoA reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05096 PE=3 SV=1 2 177 3.0E-08
sp|A7TMJ2|MKAR_VANPO Very-long-chain 3-oxoacyl-CoA reductase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_513p6 PE=3 SV=1 8 192 3.0E-08
sp|P37058|DHB3_HUMAN Testosterone 17-beta-dehydrogenase 3 OS=Homo sapiens GN=HSD17B3 PE=1 SV=2 8 174 4.0E-08
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 6 172 4.0E-08
sp|Q3T046|BDH2_BOVIN 3-hydroxybutyrate dehydrogenase type 2 OS=Bos taurus GN=BDH2 PE=2 SV=1 7 182 4.0E-08
sp|O34782|YVRD_BACSU Uncharacterized oxidoreductase YvrD OS=Bacillus subtilis (strain 168) GN=yvrD PE=3 SV=1 3 154 4.0E-08
sp|O54438|FABG_PSEAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabG PE=1 SV=1 8 236 5.0E-08
sp|Q8NEX9|DR9C7_HUMAN Short-chain dehydrogenase/reductase family 9C member 7 OS=Homo sapiens GN=SDR9C7 PE=1 SV=1 7 215 6.0E-08
sp|A5PJF6|HSDL1_BOVIN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Bos taurus GN=HSDL1 PE=2 SV=1 16 297 7.0E-08
sp|P00335|RIDH_ENTAE Ribitol 2-dehydrogenase OS=Enterobacter aerogenes GN=rbtD PE=1 SV=1 9 200 7.0E-08
sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 3 172 8.0E-08
sp|Q6PUF3|DHI1L_DANRE Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Danio rerio GN=hsd11b1l PE=2 SV=1 7 182 8.0E-08
sp|Q00791|STCU_EMENI Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 8 205 9.0E-08
sp|Q9ZW12|TRNH5_ARATH Tropinone reductase homolog At2g29260, chloroplastic OS=Arabidopsis thaliana GN=At2g29260 PE=2 SV=1 6 172 9.0E-08
sp|Q59V93|MKAR_CANAL Very-long-chain 3-oxoacyl-CoA reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.11340 PE=3 SV=2 8 192 9.0E-08
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 7 183 9.0E-08
sp|Q6R0J2|DHI1_MESAU Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Mesocricetus auratus GN=HSD11B1 PE=1 SV=3 1 176 1.0E-07
sp|O86034|BDHA_RHIME D-beta-hydroxybutyrate dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=bdhA PE=1 SV=1 6 172 1.0E-07
sp|P50842|KDUD_BACSU 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Bacillus subtilis (strain 168) GN=kduD PE=2 SV=1 3 182 1.0E-07
sp|Q2UET3|MKAR_ASPOR Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090026000492 PE=3 SV=1 8 172 1.0E-07
sp|Q561X9|BDH2_DANRE 3-hydroxybutyrate dehydrogenase type 2 OS=Danio rerio GN=bdh2 PE=2 SV=1 7 240 1.0E-07
sp|P80873|GS39_BACSU General stress protein 39 OS=Bacillus subtilis (strain 168) GN=ydaD PE=1 SV=3 8 180 1.0E-07
sp|Q9LUE4|HSD6_ARATH 11-beta-hydroxysteroid dehydrogenase-like 6 OS=Arabidopsis thaliana GN=HSD6 PE=2 SV=1 6 187 1.0E-07
sp|A3LXZ3|MKAR_PICST Very-long-chain 3-oxoacyl-CoA reductase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_79198 PE=3 SV=1 8 182 1.0E-07
sp|O49332|TRNHE_ARATH Tropinone reductase homolog At2g30670 OS=Arabidopsis thaliana GN=At2g30670 PE=3 SV=1 6 171 1.0E-07
sp|P50168|DHI2_SHEEP Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Ovis aries GN=HSD11B2 PE=2 SV=1 7 235 1.0E-07
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 3 176 2.0E-07
sp|P70385|DHB3_MOUSE Testosterone 17-beta-dehydrogenase 3 OS=Mus musculus GN=Hsd17b3 PE=1 SV=2 8 210 2.0E-07
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 8 165 2.0E-07
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 3 172 2.0E-07
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 8 203 2.0E-07
sp|Q6PUF4|DHI1L_CHICK Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Gallus gallus GN=HSD11B1L PE=2 SV=1 7 182 2.0E-07
sp|Q42182|TRNH7_ARATH Tropinone reductase homolog At2g29300 OS=Arabidopsis thaliana GN=At2g29300 PE=2 SV=2 6 235 2.0E-07
sp|Q82IY9|PTLF_STRAW 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlF PE=1 SV=1 3 182 2.0E-07
sp|Q3SXM5|HSDL1_HUMAN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Homo sapiens GN=HSDL1 PE=1 SV=3 16 176 2.0E-07
sp|Q5R7K0|HSDL1_PONAB Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Pongo abelii GN=HSDL1 PE=2 SV=1 16 176 3.0E-07
sp|Q7Z9I3|YCP8_SCHPO Uncharacterized oxidoreductase C663.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.08c PE=3 SV=1 16 182 3.0E-07
sp|O54939|DHB3_RAT Testosterone 17-beta-dehydrogenase 3 OS=Rattus norvegicus GN=Hsd17b3 PE=2 SV=1 8 210 3.0E-07
sp|P9WGT1|HSD_MYCTU 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG3 PE=1 SV=1 52 218 3.0E-07
sp|P69166|HSD_MYCBO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG3 PE=3 SV=1 52 218 3.0E-07
sp|Q94KL7|SILD_FORIN Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 8 228 4.0E-07
sp|P9WGT0|HSD_MYCTO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG3 PE=3 SV=1 52 218 4.0E-07
sp|Q9ZW15|TRNH9_ARATH Tropinone reductase homolog At2g29320 OS=Arabidopsis thaliana GN=At2g29320 PE=2 SV=1 6 171 6.0E-07
sp|P15047|ENTA_ECOLI 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Escherichia coli (strain K12) GN=entA PE=1 SV=1 6 184 6.0E-07
sp|Q92GE0|FABG_RICCN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fabG PE=3 SV=2 25 186 7.0E-07
sp|P06234|NODG_RHIME Nodulation protein G OS=Rhizobium meliloti (strain 1021) GN=nodG PE=3 SV=1 8 186 7.0E-07
sp|O77667|DHI2_BOVIN Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Bos taurus GN=HSD11B2 PE=1 SV=1 7 174 7.0E-07
sp|P14802|YOXD_BACSU Uncharacterized oxidoreductase YoxD OS=Bacillus subtilis (strain 168) GN=yoxD PE=3 SV=2 55 210 8.0E-07
sp|P40580|BZRD_YEAST Benzil reductase ((S)-benzoin forming) IRC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC24 PE=1 SV=1 6 230 8.0E-07
sp|Q6CHP1|MKAR_YARLI Very-long-chain 3-oxoacyl-CoA reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0A06787g PE=3 SV=1 8 182 9.0E-07
sp|P51975|DHI1_SHEEP Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Ovis aries GN=HSD11B1 PE=2 SV=3 1 176 9.0E-07
sp|Q53217|Y4VI_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4vI OS=Rhizobium sp. (strain NGR234) GN=NGR_a01150 PE=3 SV=2 6 182 9.0E-07
sp|P50164|TRN2_HYONI Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1 6 172 9.0E-07
sp|Q9ZW03|TRNH3_ARATH Tropinone reductase homolog At2g29150 OS=Arabidopsis thaliana GN=At2g29150 PE=1 SV=1 6 172 9.0E-07
sp|Q9ZW13|TRNH6_ARATH Tropinone reductase homolog At2g29290 OS=Arabidopsis thaliana GN=At2g29290 PE=2 SV=1 8 164 1.0E-06
sp|P72332|NODG_RHIS3 Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1 8 186 1.0E-06
sp|Q9ZW14|TRNH8_ARATH Tropinone reductase homolog At2g29310 OS=Arabidopsis thaliana GN=At2g29310 PE=2 SV=1 6 171 1.0E-06
sp|P23238|PHBB_ZOORA Acetoacetyl-CoA reductase OS=Zoogloea ramigera GN=phbB PE=3 SV=1 8 228 2.0E-06
sp|P33368|YOHF_ECOLI Uncharacterized oxidoreductase YohF OS=Escherichia coli (strain K12) GN=yohF PE=3 SV=2 76 165 2.0E-06
sp|Q9ZW04|TRNH4_ARATH Tropinone reductase homolog At2g29170 OS=Arabidopsis thaliana GN=At2g29170 PE=3 SV=1 6 172 2.0E-06
sp|Q9ZW16|TRNHA_ARATH Tropinone reductase homolog At2g29330 OS=Arabidopsis thaliana GN=TRI PE=1 SV=1 6 171 2.0E-06
sp|Q6QA33|DH12B_DANRE Very-long-chain 3-oxoacyl-CoA reductase-B OS=Danio rerio GN=hsd17b12b PE=2 SV=2 8 202 2.0E-06
sp|P66782|Y1385_MYCBO Uncharacterized oxidoreductase Mb1385 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG2 PE=3 SV=1 6 202 2.0E-06
sp|P9WGR9|Y1350_MYCTU Uncharacterized oxidoreductase Rv1350 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG2 PE=1 SV=1 6 202 2.0E-06
sp|P9WGR8|Y1350_MYCTO Uncharacterized oxidoreductase MT1393 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG2 PE=3 SV=1 6 202 2.0E-06
sp|Q22230|DECR_CAEEL Probable 2,4-dienoyl-CoA reductase 3 OS=Caenorhabditis elegans GN=decr-1.3 PE=3 SV=1 8 171 2.0E-06
sp|A4IFA7|CBR4_BOVIN Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 16 182 2.0E-06
sp|P39333|BDCA_ECOLI Cyclic-di-GMP-binding biofilm dispersal mediator protein OS=Escherichia coli (strain K12) GN=bdcA PE=1 SV=2 6 193 2.0E-06
sp|Q10245|MKAR_SCHPO Very-long-chain 3-oxoacyl-CoA reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.15 PE=3 SV=1 8 172 2.0E-06
sp|Q988B7|PLDH_RHILO Pyridoxal 4-dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=pldh-t PE=1 SV=1 6 231 2.0E-06
sp|Q4UK62|FABG_RICFE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fabG PE=3 SV=1 25 186 2.0E-06
sp|P08074|CBR2_MOUSE Carbonyl reductase [NADPH] 2 OS=Mus musculus GN=Cbr2 PE=1 SV=1 8 172 2.0E-06
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 3 186 2.0E-06
sp|P87025|THR1_COLOR Trihydroxynaphthalene reductase OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=THR1 PE=3 SV=4 8 185 3.0E-06
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 1 193 3.0E-06
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 1 193 3.0E-06
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 1 193 3.0E-06
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 1 193 3.0E-06
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 1 193 3.0E-06
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 1 193 3.0E-06
sp|P0A9P9|IDNO_ECOLI Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1 6 172 3.0E-06
sp|P0A9Q0|IDNO_ECOL6 Gluconate 5-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idnO PE=3 SV=1 6 172 3.0E-06
sp|Q21929|DCXR_CAEEL L-xylulose reductase OS=Caenorhabditis elegans GN=dhs-21 PE=1 SV=2 7 172 4.0E-06
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 7 182 4.0E-06
sp|P0AG84|YGHA_ECOLI Uncharacterized oxidoreductase YghA OS=Escherichia coli (strain K12) GN=yghA PE=1 SV=1 8 180 5.0E-06
sp|P0AG85|YGHA_ECO57 Uncharacterized oxidoreductase YghA OS=Escherichia coli O157:H7 GN=yghA PE=3 SV=1 8 180 5.0E-06
sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum brasilense GN=nodG PE=3 SV=2 8 172 5.0E-06
sp|P50198|LINX_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linX PE=3 SV=1 8 200 6.0E-06
sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 7 172 6.0E-06
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 7 172 8.0E-06
sp|Q29608|DHI1_SAISC Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Saimiri sciureus GN=HSD11B1 PE=2 SV=3 1 182 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6593
MKRKTTVLITGCSPGGIGYALAVAFHRRGCHVIATARRDVLGDLADMGMSTLRLDVTDAASVAACKDDVAKMTDC
KLDILVNNAGFFYCMPALDYDVDEAKRLFDTNLFGTMRMCQALSGLLIAARGLIINTSSVSSKLPAPFHSVYAAS
KAAMNAYSDVLRVEMEPLGVRVMVTITGSVQSHVYDGPPTSLPAGSRYEPAREYFQRALKAADNIRLCPPMPAER
YAEHVAGKTLPKGWRRRLLGGTPHSVWKGGGATRTWLLDRVGLSWLTSWAMLISLPPGPSWDLLRRSVRAKAS*
Coding >Hirsu2|6593
ATGAAGCGGAAGACGACCGTTCTCATCACCGGCTGCTCGCCCGGGGGCATAGGCTATGCGCTGGCCGTTGCCTTT
CACCGCCGCGGCTGCCATGTCATCGCCACGGCTCGCAGGGACGTGCTCGGCGACCTGGCCGACATGGGCATGAGC
ACGCTCCGGCTGGACGTGACGGATGCGGCGAGCGTCGCCGCGTGCAAGGACGATGTGGCCAAGATGACGGACTGC
AAGCTTGATATACTGGTAAACAACGCGGGGTTCTTCTACTGCATGCCAGCCCTGGACTATGACGTGGACGAGGCC
AAGAGACTATTCGACACCAACCTCTTCGGGACGATGCGCATGTGCCAGGCCCTGAGCGGGCTCCTGATCGCCGCG
CGCGGCCTTATCATCAACACCTCGTCTGTCTCCTCTAAGCTTCCTGCCCCCTTCCACAGCGTCTACGCGGCGAGC
AAGGCCGCCATGAACGCGTACTCGGACGTGCTGCGCGTCGAGATGGAGCCGCTGGGCGTGCGCGTCATGGTCACG
ATTACGGGCTCGGTGCAGTCACACGTCTACGACGGCCCGCCGACCAGCCTGCCGGCCGGGTCGCGGTACGAGCCG
GCGCGCGAGTACTTCCAGAGGGCCTTGAAGGCAGCCGACAACATAAGGCTTTGCCCCCCCATGCCAGCGGAGCGG
TATGCCGAGCACGTCGCCGGCAAGACCCTCCCGAAAGGCTGGAGACGACGACTCCTCGGCGGCACGCCGCACTCG
GTCTGGAAGGGAGGAGGCGCAACCCGGACCTGGCTGCTGGACCGGGTCGGCCTCTCGTGGCTCACGAGCTGGGCG
ATGTTAATATCCTTACCGCCAGGCCCATCCTGGGACCTGCTGCGGCGAAGCGTGCGGGCCAAGGCGAGCTGA
Transcript >Hirsu2|6593
ATGAAGCGGAAGACGACCGTTCTCATCACCGGCTGCTCGCCCGGGGGCATAGGCTATGCGCTGGCCGTTGCCTTT
CACCGCCGCGGCTGCCATGTCATCGCCACGGCTCGCAGGGACGTGCTCGGCGACCTGGCCGACATGGGCATGAGC
ACGCTCCGGCTGGACGTGACGGATGCGGCGAGCGTCGCCGCGTGCAAGGACGATGTGGCCAAGATGACGGACTGC
AAGCTTGATATACTGGTAAACAACGCGGGGTTCTTCTACTGCATGCCAGCCCTGGACTATGACGTGGACGAGGCC
AAGAGACTATTCGACACCAACCTCTTCGGGACGATGCGCATGTGCCAGGCCCTGAGCGGGCTCCTGATCGCCGCG
CGCGGCCTTATCATCAACACCTCGTCTGTCTCCTCTAAGCTTCCTGCCCCCTTCCACAGCGTCTACGCGGCGAGC
AAGGCCGCCATGAACGCGTACTCGGACGTGCTGCGCGTCGAGATGGAGCCGCTGGGCGTGCGCGTCATGGTCACG
ATTACGGGCTCGGTGCAGTCACACGTCTACGACGGCCCGCCGACCAGCCTGCCGGCCGGGTCGCGGTACGAGCCG
GCGCGCGAGTACTTCCAGAGGGCCTTGAAGGCAGCCGACAACATAAGGCTTTGCCCCCCCATGCCAGCGGAGCGG
TATGCCGAGCACGTCGCCGGCAAGACCCTCCCGAAAGGCTGGAGACGACGACTCCTCGGCGGCACGCCGCACTCG
GTCTGGAAGGGAGGAGGCGCAACCCGGACCTGGCTGCTGGACCGGGTCGGCCTCTCGTGGCTCACGAGCTGGGCG
ATGTTAATATCCTTACCGCCAGGCCCATCCTGGGACCTGCTGCGGCGAAGCGTGCGGGCCAAGGCGAGCTGA
Gene >Hirsu2|6593
ATGAAGCGGAAGACGACCGTTCTCATCACCGGGTAAGTCCGGGGCCGGGCCCGTCGACGTCGACTCGGCAGGGCG
TGACTGGCTGATACACGCGGCGTCCCAGCTGCTCGCCCGGGGGCATAGGCTATGCGCTGGCCGTTGCCTTTCACC
GCCGCGGTTCGTCTGGTCCCTCCCCTGAGCGAAGAATGTCGAGAGAGGGTGGAGGGAGTTGATAGGAGTGGAATC
TAACCGCGGCACGCAGGCTGCCATGTCATCGCCACGGCTCGCAGGGACGTGCTCGGCGACCTGGCCGACATGGGC
ATGAGCACGCTCCGGCTGGACGTGACGGATGCGGCGAGCGTCGCCGCGTGCAAGGACGATGTGGCCAAGATGACG
GACTGCAAGCTTGATATACTGGTAAACAACGCGTAAGTGCCGGGCCTGCCATCAGACACGCTCACCCCCACCACC
CCCCCCTTCCAGGCGTCGAGGTCGAGCAGGCCGACGAGGCGTTGACGGAAGCTCATCTCCAGGGGGTTCTTCTAC
TGCATGCCAGCCCTGGACTATGACGTGGACGAGGCCAAGAGACTATTCGACACCAACCTCTTCGGGACGATGCGC
ATGTGCCAGGCCCTGAGCGGGCTCCTGATCGCCGCGCGCGGCCTTATCATCAACACCTCGTCTGTCTCCTCTAAG
CTTCCTGCCCCCTTCCACAGCGTCTACGCGGCGAGCAAGGCCGCCATGAACGCGTACTCGGACGTGCTGCGCGTC
GAGATGGAGCCGCTGGGCGTGCGCGTCATGGTCACGATTACGGGCTCGGTGCAGTCACACGTCTACGACGGCCCG
CCGACCAGCCTGCCGGCCGGGTCGCGGTACGAGCCGGCGCGCGAGTACTTCCAGAGGGCCTTGAAGGCAGCCGAC
AACATAAGGCTTTGCCCCCCCATGCCAGCGGAGCGGTATGCCGAGCACGTCGCCGGCAAGACCCTCCCGAAAGGC
TGGAGACGACGACTCCTCGGCGGCACGCCGCACTCGGTCTGGAAGGGAGGAGGCGCAACCCGGACCTGGCTGCTG
GACCGGGTCGGCCTCTCGTGGCTCACGAGCTGGGCGATGTTAATATCCTTACCGCCAGGCCCATCCTGGGACCTG
CTGCGGCGAAGCGTGCGGGCCAAGGCGAGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail