Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6592
Gene name
LocationContig_342:10346..12083
Strand+
Gene length (bp)1737
Transcript length (bp)1671
Coding sequence length (bp)1671
Protein length (aa) 557

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12756 zf-C2H2_2 C2H2 type zinc-finger (2 copies) 2.5E-28 212 308
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 9.9E-07 86 109
PF12874 zf-met Zinc-finger of C2H2 type 1.4E-06 85 108

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0S920|REI1_CHATD Cytoplasmic 60S subunit biogenesis factor REI1 homolog OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0044240 PE=3 SV=2 1 536 3.0E-178
sp|O59811|REI1_SCHPO Cytoplasmic 60S subunit biogenesis factor SPCC550.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.15c PE=1 SV=1 16 328 2.0E-59
sp|Q7TM96|ZN622_RAT Zinc finger protein 622 OS=Rattus norvegicus GN=Znf622 PE=1 SV=2 19 329 2.0E-43
sp|Q91VY9|ZN622_MOUSE Zinc finger protein 622 OS=Mus musculus GN=Znf622 PE=1 SV=1 20 340 2.0E-40
sp|Q06709|REH1_YEAST Cytoplasmic 60S subunit biogenesis factor REH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REH1 PE=1 SV=1 15 519 2.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0S920|REI1_CHATD Cytoplasmic 60S subunit biogenesis factor REI1 homolog OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0044240 PE=3 SV=2 1 536 3.0E-178
sp|O59811|REI1_SCHPO Cytoplasmic 60S subunit biogenesis factor SPCC550.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.15c PE=1 SV=1 16 328 2.0E-59
sp|Q7TM96|ZN622_RAT Zinc finger protein 622 OS=Rattus norvegicus GN=Znf622 PE=1 SV=2 19 329 2.0E-43
sp|Q91VY9|ZN622_MOUSE Zinc finger protein 622 OS=Mus musculus GN=Znf622 PE=1 SV=1 20 340 2.0E-40
sp|Q06709|REH1_YEAST Cytoplasmic 60S subunit biogenesis factor REH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REH1 PE=1 SV=1 15 519 2.0E-37
sp|Q90Y35|ZN622_CHICK Zinc finger protein 622 OS=Gallus gallus GN=ZNF622 PE=2 SV=1 19 180 6.0E-24
sp|Q969S3|ZN622_HUMAN Zinc finger protein 622 OS=Homo sapiens GN=ZNF622 PE=1 SV=1 212 323 6.0E-22
sp|Q90Y35|ZN622_CHICK Zinc finger protein 622 OS=Gallus gallus GN=ZNF622 PE=2 SV=1 212 317 2.0E-21
sp|P38344|REI1_YEAST Cytoplasmic 60S subunit biogenesis factor REI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REI1 PE=1 SV=3 212 326 4.0E-21
sp|Q969S3|ZN622_HUMAN Zinc finger protein 622 OS=Homo sapiens GN=ZNF622 PE=1 SV=1 19 108 9.0E-20
sp|P38344|REI1_YEAST Cytoplasmic 60S subunit biogenesis factor REI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REI1 PE=1 SV=3 14 62 6.0E-13
sp|O74977|VMS1_SCHPO VMS1 homolog C1827.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.04 PE=1 SV=1 20 66 1.0E-06
sp|Q8AVN9|ZN346_XENLA Zinc finger protein 346 OS=Xenopus laevis GN=znf346 PE=1 SV=1 10 203 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6592
MASVNAGTGASGTAASHPYTCNTCQVAYRNIDLQKGHMKSDWHRYNLKRRVASLPPISSEVFTSKVLQARAATSA
EADKALFERTCDACGKTYYSENAYQNHLLSQKHKQNLSATPHQRHDDETTSVVSSTFSLGEPAALSQDHHIDTDV
EDEFNLVIESLQNAKLAQQRSSPVKRPSNPQPRGAEADSNGASNDGASTAAGPEPAWTPNCCLFCNYSSPTVPLN
ASHMERFHGMFIPEKPYLADLEGLITHLQRQVGQHHQCLSCGKTKTTIFAVQTHMRDKGHCKIPFSTEQEQLRIG
DFYDFRSTYSDGGEDEDEDEDDEESDGDVTLGQQGGAKLGLKRRAQVIGPDGEARDDDDAEGWETDSSVSSLDSA
DLTAVPAEGHIHQFERLSKHSHHSRHDPGHRHQLDGWHSRAHRHTHAVFHDDYELHLPSGKSVGHRSLNRYFRQN
LARYPTEEEREERLAIEGPGSDREGEGEASEGPNRQIAVRGARGRELLPRGAEGMMGVSNDKRREVRKVQQRGRD
AESHRNKKNEWSYGMRANNQKNYYYRYDGGG*
Coding >Hirsu2|6592
ATGGCGAGCGTCAACGCCGGCACCGGCGCCTCCGGCACAGCGGCTTCGCACCCCTACACCTGCAACACGTGCCAG
GTTGCCTACCGCAACATCGACTTGCAAAAGGGCCATATGAAGAGCGATTGGCACCGCTACAACTTGAAGCGTCGT
GTGGCTTCCCTGCCCCCCATCTCCTCCGAAGTCTTCACCAGCAAGGTTCTTCAGGCGCGTGCCGCCACCTCGGCC
GAGGCCGACAAGGCTCTCTTTGAGCGCACGTGCGACGCTTGCGGCAAGACTTACTACAGTGAAAATGCCTACCAG
AATCACCTCCTCAGCCAGAAGCACAAGCAGAACCTGTCCGCGACGCCGCACCAACGCCACGATGACGAAACTACC
TCTGTCGTCAGCTCCACCTTTTCCCTGGGAGAGCCGGCCGCGCTCTCCCAGGACCATCACATCGACACCGATGTC
GAGGATGAGTTCAACCTGGTCATCGAAAGCCTGCAGAACGCCAAGCTGGCCCAACAACGCTCCTCTCCCGTCAAG
CGCCCCTCCAACCCTCAACCTCGCGGGGCCGAGGCCGACAGCAACGGCGCCTCCAACGACGGCGCCTCCACCGCG
GCCGGGCCCGAGCCCGCCTGGACCCCCAACTGCTGCCTCTTCTGCAACTACTCCTCCCCCACTGTCCCCCTCAAC
GCCAGCCACATGGAGCGCTTTCACGGCATGTTCATCCCCGAGAAGCCATATCTCGCGGACCTGGAAGGCCTCATC
ACCCACCTCCAGCGACAGGTCGGCCAACATCATCAATGTCTGAGTTGCGGCAAGACGAAGACGACCATCTTCGCG
GTCCAGACCCACATGCGCGACAAGGGCCATTGCAAGATTCCCTTCAGCACCGAGCAGGAGCAGCTGAGAATCGGA
GACTTTTACGACTTCAGGAGCACGTACTCGGACGGCGGCGAGGACGAGGACGAGGACGAGGACGACGAAGAGTCG
GACGGCGACGTCACCCTAGGACAACAGGGCGGCGCCAAGCTGGGCTTGAAGCGACGTGCCCAAGTCATCGGTCCG
GACGGCGAGGCTCGAGACGACGACGATGCCGAGGGCTGGGAAACGGACAGCTCCGTGTCTTCGCTCGACTCGGCC
GACCTGACAGCTGTGCCCGCCGAGGGGCACATTCACCAGTTTGAGCGGCTCAGCAAGCACTCACACCATTCGCGC
CACGACCCGGGACACCGCCATCAGCTGGACGGCTGGCACTCGCGGGCGCACAGGCACACTCATGCCGTCTTCCAC
GACGACTACGAGCTCCACCTGCCGTCGGGCAAGTCCGTCGGCCACCGTTCGCTGAACCGGTATTTCCGGCAAAAC
CTCGCCCGCTATCCCACGGAAGAGGAGCGGGAGGAGCGGCTCGCCATCGAGGGGCCCGGATCCGACCGGGAAGGC
GAGGGAGAGGCGTCCGAGGGCCCCAACAGGCAGATTGCCGTCCGCGGCGCCCGCGGCCGAGAGTTGCTGCCACGC
GGGGCCGAGGGCATGATGGGCGTCTCGAACGACAAGAGGCGCGAGGTACGCAAGGTGCAACAGCGCGGCCGAGAC
GCCGAGAGCCATCGGAACAAGAAGAACGAGTGGTCGTACGGGATGCGGGCCAACAACCAGAAGAACTACTACTAC
CGCTACGACGGCGGCGGTTAG
Transcript >Hirsu2|6592
ATGGCGAGCGTCAACGCCGGCACCGGCGCCTCCGGCACAGCGGCTTCGCACCCCTACACCTGCAACACGTGCCAG
GTTGCCTACCGCAACATCGACTTGCAAAAGGGCCATATGAAGAGCGATTGGCACCGCTACAACTTGAAGCGTCGT
GTGGCTTCCCTGCCCCCCATCTCCTCCGAAGTCTTCACCAGCAAGGTTCTTCAGGCGCGTGCCGCCACCTCGGCC
GAGGCCGACAAGGCTCTCTTTGAGCGCACGTGCGACGCTTGCGGCAAGACTTACTACAGTGAAAATGCCTACCAG
AATCACCTCCTCAGCCAGAAGCACAAGCAGAACCTGTCCGCGACGCCGCACCAACGCCACGATGACGAAACTACC
TCTGTCGTCAGCTCCACCTTTTCCCTGGGAGAGCCGGCCGCGCTCTCCCAGGACCATCACATCGACACCGATGTC
GAGGATGAGTTCAACCTGGTCATCGAAAGCCTGCAGAACGCCAAGCTGGCCCAACAACGCTCCTCTCCCGTCAAG
CGCCCCTCCAACCCTCAACCTCGCGGGGCCGAGGCCGACAGCAACGGCGCCTCCAACGACGGCGCCTCCACCGCG
GCCGGGCCCGAGCCCGCCTGGACCCCCAACTGCTGCCTCTTCTGCAACTACTCCTCCCCCACTGTCCCCCTCAAC
GCCAGCCACATGGAGCGCTTTCACGGCATGTTCATCCCCGAGAAGCCATATCTCGCGGACCTGGAAGGCCTCATC
ACCCACCTCCAGCGACAGGTCGGCCAACATCATCAATGTCTGAGTTGCGGCAAGACGAAGACGACCATCTTCGCG
GTCCAGACCCACATGCGCGACAAGGGCCATTGCAAGATTCCCTTCAGCACCGAGCAGGAGCAGCTGAGAATCGGA
GACTTTTACGACTTCAGGAGCACGTACTCGGACGGCGGCGAGGACGAGGACGAGGACGAGGACGACGAAGAGTCG
GACGGCGACGTCACCCTAGGACAACAGGGCGGCGCCAAGCTGGGCTTGAAGCGACGTGCCCAAGTCATCGGTCCG
GACGGCGAGGCTCGAGACGACGACGATGCCGAGGGCTGGGAAACGGACAGCTCCGTGTCTTCGCTCGACTCGGCC
GACCTGACAGCTGTGCCCGCCGAGGGGCACATTCACCAGTTTGAGCGGCTCAGCAAGCACTCACACCATTCGCGC
CACGACCCGGGACACCGCCATCAGCTGGACGGCTGGCACTCGCGGGCGCACAGGCACACTCATGCCGTCTTCCAC
GACGACTACGAGCTCCACCTGCCGTCGGGCAAGTCCGTCGGCCACCGTTCGCTGAACCGGTATTTCCGGCAAAAC
CTCGCCCGCTATCCCACGGAAGAGGAGCGGGAGGAGCGGCTCGCCATCGAGGGGCCCGGATCCGACCGGGAAGGC
GAGGGAGAGGCGTCCGAGGGCCCCAACAGGCAGATTGCCGTCCGCGGCGCCCGCGGCCGAGAGTTGCTGCCACGC
GGGGCCGAGGGCATGATGGGCGTCTCGAACGACAAGAGGCGCGAGGTACGCAAGGTGCAACAGCGCGGCCGAGAC
GCCGAGAGCCATCGGAACAAGAAGAACGAGTGGTCGTACGGGATGCGGGCCAACAACCAGAAGAACTACTACTAC
CGCTACGACGGCGGCGGTTAG
Gene >Hirsu2|6592
ATGGCGAGCGTCAACGCCGGCACCGGCGCCTCCGGCACAGCGGCTTCGCACCCCTACACCTGCAACACGTGCCAG
GTTGCCTACCGCAACATCGACTTGCAAAAGGGCCATATGAAGAGCGATTGGCAGTCAGTGCCTCCCAGCCCCAGC
CCCTTTGCTGACGCCCCTGCTGATGGTCAGCCTCGCCGGTCTAGCCGCTACAACTTGAAGCGTCGTGTGGCTTCC
CTGCCCCCCATCTCCTCCGAAGTCTTCACCAGCAAGGTTCTTCAGGCGCGTGCCGCCACCTCGGCCGAGGCCGAC
AAGGCTCTCTTTGAGCGCACGTGCGACGCTTGCGGCAAGACTTACTACAGTGAAAATGCCTACCAGAATCACCTC
CTCAGCCAGAAGCACAAGCAGAACCTGTCCGCGACGCCGCACCAACGCCACGATGACGAAACTACCTCTGTCGTC
AGCTCCACCTTTTCCCTGGGAGAGCCGGCCGCGCTCTCCCAGGACCATCACATCGACACCGATGTCGAGGATGAG
TTCAACCTGGTCATCGAAAGCCTGCAGAACGCCAAGCTGGCCCAACAACGCTCCTCTCCCGTCAAGCGCCCCTCC
AACCCTCAACCTCGCGGGGCCGAGGCCGACAGCAACGGCGCCTCCAACGACGGCGCCTCCACCGCGGCCGGGCCC
GAGCCCGCCTGGACCCCCAACTGCTGCCTCTTCTGCAACTACTCCTCCCCCACTGTCCCCCTCAACGCCAGCCAC
ATGGAGCGCTTTCACGGCATGTTCATCCCCGAGAAGCCATATCTCGCGGACCTGGAAGGCCTCATCACCCACCTC
CAGCGACAGGTCGGCCAACATCATCAATGTCTGAGTTGCGGCAAGACGAAGACGACCATCTTCGCGGTCCAGACC
CACATGCGCGACAAGGGCCATTGCAAGATTCCCTTCAGCACCGAGCAGGAGCAGCTGAGAATCGGAGACTTTTAC
GACTTCAGGAGCACGTACTCGGACGGCGGCGAGGACGAGGACGAGGACGAGGACGACGAAGAGTCGGACGGCGAC
GTCACCCTAGGACAACAGGGCGGCGCCAAGCTGGGCTTGAAGCGACGTGCCCAAGTCATCGGTCCGGACGGCGAG
GCTCGAGACGACGACGATGCCGAGGGCTGGGAAACGGACAGCTCCGTGTCTTCGCTCGACTCGGCCGACCTGACA
GCTGTGCCCGCCGAGGGGCACATTCACCAGTTTGAGCGGCTCAGCAAGCACTCACACCATTCGCGCCACGACCCG
GGACACCGCCATCAGCTGGACGGCTGGCACTCGCGGGCGCACAGGCACACTCATGCCGTCTTCCACGACGACTAC
GAGCTCCACCTGCCGTCGGGCAAGTCCGTCGGCCACCGTTCGCTGAACCGGTATTTCCGGCAAAACCTCGCCCGC
TATCCCACGGAAGAGGAGCGGGAGGAGCGGCTCGCCATCGAGGGGCCCGGATCCGACCGGGAAGGCGAGGGAGAG
GCGTCCGAGGGCCCCAACAGGCAGATTGCCGTCCGCGGCGCCCGCGGCCGAGAGTTGCTGCCACGCGGGGCCGAG
GGCATGATGGGCGTCTCGAACGACAAGAGGCGCGAGGTACGCAAGGTGCAACAGCGCGGCCGAGACGCCGAGAGC
CATCGGAACAAGAAGAACGAGTGGTCGTACGGGATGCGGGCCAACAACCAGAAGAACTACTACTACCGCTACGAC
GGCGGCGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail