Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6586
Gene name
LocationContig_341:19276..20029
Strand-
Gene length (bp)753
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11968 Bmt2 25S rRNA (adenine(2142)-N(1))-methyltransferase, Bmt2 1.7E-83 2 219

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38278|BMT2_YEAST 25S rRNA (adenine(2142)-N(1))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BMT2 PE=1 SV=2 4 221 2.0E-50
sp|Q9UUH2|BMT2_SCHPO 25S rRNA adenine-N(1) methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC630.10 PE=3 SV=1 10 219 2.0E-39

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6586
MSAEIAALGGLEQYQQASLQGQSLERGGDTSKILLEWLPISELRSLGRRLRMLEIGALSTRNACSTSGLFDMVHI
DLKSREPGILQQDFMERPLPGAEAEKFDIISLSLVLNFVPEAATRGLMLARSLSFLRGGAEKPGLPTPSLFMVLP
RSCVTNSRYFSETRLQELMGALGYELVKAQQSHKLAYSLWQLRGAQAQADIRFTKQEVNPGRKRNNFVVTLSHPV
NQRQACIGESRMAGQDVSDAQAAKT*
Coding >Hirsu2|6586
ATGTCGGCGGAGATTGCGGCCCTTGGGGGGCTGGAGCAGTACCAGCAGGCGAGCCTCCAGGGGCAGAGCCTTGAG
CGAGGAGGAGACACGTCCAAGATACTGCTGGAGTGGCTGCCCATCTCGGAATTGAGGAGCTTGGGCCGGCGACTC
AGAATGCTCGAGATTGGAGCCCTGAGCACTCGCAATGCTTGCTCGACCAGTGGCCTGTTCGACATGGTACACATC
GACCTCAAGAGCCGGGAGCCCGGAATCCTGCAGCAAGACTTTATGGAACGTCCACTCCCCGGGGCGGAAGCAGAA
AAATTCGACATCATCTCCCTGAGCCTCGTCCTGAACTTTGTGCCCGAGGCCGCCACCCGTGGTCTGATGCTCGCT
CGCTCGCTGTCCTTCCTGCGAGGCGGCGCCGAGAAGCCTGGACTCCCGACGCCGTCCCTTTTCATGGTCCTGCCT
CGCAGCTGCGTCACCAATTCACGTTACTTCTCAGAGACAAGACTACAGGAGCTAATGGGGGCGCTTGGCTATGAA
CTGGTCAAGGCTCAGCAATCGCACAAGCTTGCGTATAGTTTGTGGCAACTGCGTGGCGCACAGGCGCAGGCTGAC
ATCCGGTTCACCAAGCAAGAGGTCAATCCCGGTCGGAAGAGAAACAACTTTGTTGTGACTCTGAGCCACCCAGTC
AATCAGCGGCAGGCCTGCATCGGCGAGAGCAGAATGGCTGGCCAAGACGTTTCGGACGCGCAAGCAGCAAAAACG
TAG
Transcript >Hirsu2|6586
ATGTCGGCGGAGATTGCGGCCCTTGGGGGGCTGGAGCAGTACCAGCAGGCGAGCCTCCAGGGGCAGAGCCTTGAG
CGAGGAGGAGACACGTCCAAGATACTGCTGGAGTGGCTGCCCATCTCGGAATTGAGGAGCTTGGGCCGGCGACTC
AGAATGCTCGAGATTGGAGCCCTGAGCACTCGCAATGCTTGCTCGACCAGTGGCCTGTTCGACATGGTACACATC
GACCTCAAGAGCCGGGAGCCCGGAATCCTGCAGCAAGACTTTATGGAACGTCCACTCCCCGGGGCGGAAGCAGAA
AAATTCGACATCATCTCCCTGAGCCTCGTCCTGAACTTTGTGCCCGAGGCCGCCACCCGTGGTCTGATGCTCGCT
CGCTCGCTGTCCTTCCTGCGAGGCGGCGCCGAGAAGCCTGGACTCCCGACGCCGTCCCTTTTCATGGTCCTGCCT
CGCAGCTGCGTCACCAATTCACGTTACTTCTCAGAGACAAGACTACAGGAGCTAATGGGGGCGCTTGGCTATGAA
CTGGTCAAGGCTCAGCAATCGCACAAGCTTGCGTATAGTTTGTGGCAACTGCGTGGCGCACAGGCGCAGGCTGAC
ATCCGGTTCACCAAGCAAGAGGTCAATCCCGGTCGGAAGAGAAACAACTTTGTTGTGACTCTGAGCCACCCAGTC
AATCAGCGGCAGGCCTGCATCGGCGAGAGCAGAATGGCTGGCCAAGACGTTTCGGACGCGCAAGCAGCAAAAACG
TAG
Gene >Hirsu2|6586
ATGTCGGCGGAGATTGCGGCCCTTGGGGGGCTGGAGCAGTACCAGCAGGCGAGCCTCCAGGGGCAGAGCCTTGAG
CGAGGAGGAGACACGTCCAAGATACTGCTGGAGTGGCTGCCCATCTCGGAATTGAGGAGCTTGGGCCGGCGACTC
AGAATGCTCGAGATTGGAGCCCTGAGCACTCGCAATGCTTGCTCGACCAGTGGCCTGTTCGACATGGTACACATC
GACCTCAAGAGCCGGGAGCCCGGAATCCTGCAGCAAGACTTTATGGAACGTCCACTCCCCGGGGCGGAAGCAGAA
AAATTCGACATCATCTCCCTGAGCCTCGTCCTGAACTTTGTGCCCGAGGCCGCCACCCGTGGTCTGATGCTCGCT
CGCTCGCTGTCCTTCCTGCGAGGCGGCGCCGAGAAGCCTGGACTCCCGACGCCGTCCCTTTTCATGGTCCTGCCT
CGCAGCTGCGTCACCAATTCACGTTACTTCTCAGAGACAAGACTACAGGAGCTAATGGGGGCGCTTGGCTATGAA
CTGGTCAAGGCTCAGCAATCGCACAAGCTTGCGTATAGTTTGTGGCAACTGCGTGGCGCACAGGCGCAGGCTGAC
ATCCGGTTCACCAAGCAAGAGGTCAATCCCGGTCGGAAGAGAAACAACTTTGTTGTGACTCTGAGCCACCCAGTC
AATCAGCGGCAGGCCTGCATCGGCGAGAGCAGAATGGCTGGCCAAGACGTTTCGGACGCGCAAGCAGCAAAAACG
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail