Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6583
Gene name
LocationContig_341:8755..10624
Strand-
Gene length (bp)1869
Transcript length (bp)1869
Coding sequence length (bp)1869
Protein length (aa) 623

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 5.2E-54 18 269
PF07714 Pkinase_Tyr Protein tyrosine kinase 3.3E-34 21 269
PF14531 Kinase-like Kinase-like 8.5E-11 116 227

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14328|KSP1_SCHPO Serine/threonine-protein kinase ksp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksp1 PE=1 SV=1 18 317 3.0E-82
sp|P38691|KSP1_YEAST Serine/threonine-protein kinase KSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KSP1 PE=1 SV=1 70 301 5.0E-53
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 13 222 3.0E-34
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 10 271 6.0E-34
sp|P08092|RAN1_SCHPO Negative regulator of sexual conjugation and meiosis OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ran1 PE=1 SV=2 4 268 7.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14328|KSP1_SCHPO Serine/threonine-protein kinase ksp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksp1 PE=1 SV=1 18 317 3.0E-82
sp|P38691|KSP1_YEAST Serine/threonine-protein kinase KSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KSP1 PE=1 SV=1 70 301 5.0E-53
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 13 222 3.0E-34
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 10 271 6.0E-34
sp|P08092|RAN1_SCHPO Negative regulator of sexual conjugation and meiosis OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ran1 PE=1 SV=2 4 268 7.0E-34
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 10 222 2.0E-33
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 13 268 3.0E-33
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 13 268 6.0E-33
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 16 222 9.0E-33
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 16 222 1.0E-32
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 14 271 2.0E-32
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 14 271 2.0E-32
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 16 268 3.0E-32
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 16 268 4.0E-32
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 16 271 5.0E-32
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 13 222 6.0E-32
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 10 268 6.0E-32
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 13 290 1.0E-31
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 16 226 2.0E-31
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 13 222 2.0E-31
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 16 271 2.0E-31
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 11 222 5.0E-31
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 11 226 5.0E-31
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 11 226 7.0E-31
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 16 318 1.0E-30
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 13 222 3.0E-30
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 14 271 3.0E-30
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 13 271 4.0E-30
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 16 271 4.0E-30
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 16 268 6.0E-30
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 13 268 7.0E-30
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 10 268 1.0E-29
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 11 222 1.0E-29
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 11 222 1.0E-29
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 13 222 2.0E-29
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 10 222 2.0E-29
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 12 222 2.0E-29
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 13 222 3.0E-29
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 24 268 4.0E-29
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 2 222 6.0E-29
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 13 271 7.0E-29
sp|Q23023|UNC51_CAEEL Serine/threonine-protein kinase unc-51 OS=Caenorhabditis elegans GN=unc-51 PE=1 SV=1 24 226 9.0E-29
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 10 222 1.0E-28
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 16 222 1.0E-28
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 18 276 1.0E-28
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 24 268 2.0E-28
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 18 271 2.0E-28
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 11 222 2.0E-28
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 14 271 2.0E-28
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 14 272 3.0E-28
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 12 222 3.0E-28
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 24 231 3.0E-28
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 24 231 4.0E-28
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 24 231 4.0E-28
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 17 271 4.0E-28
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 14 229 5.0E-28
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 16 222 6.0E-28
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 16 222 7.0E-28
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 16 269 1.0E-27
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 16 269 1.0E-27
sp|P34331|PLK1_CAEEL Serine/threonine-protein kinase plk-1 OS=Caenorhabditis elegans GN=plk-1 PE=1 SV=3 6 268 1.0E-27
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 23 268 1.0E-27
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 8 222 2.0E-27
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 11 222 2.0E-27
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 16 222 2.0E-27
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 18 271 2.0E-27
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 18 268 3.0E-27
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 14 268 3.0E-27
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 14 268 3.0E-27
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 14 268 4.0E-27
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 6 273 4.0E-27
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 18 271 6.0E-27
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 4 224 6.0E-27
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 16 222 7.0E-27
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 13 268 8.0E-27
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 11 223 9.0E-27
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 18 271 9.0E-27
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 14 268 1.0E-26
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 14 269 1.0E-26
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 16 222 1.0E-26
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 14 269 1.0E-26
sp|B3DL84|PLK4_XENTR Serine/threonine-protein kinase PLK4 OS=Xenopus tropicalis GN=plk4 PE=2 SV=1 18 231 2.0E-26
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 16 268 2.0E-26
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 12 268 2.0E-26
sp|Q6PAD2|PLK4_XENLA Serine/threonine-protein kinase PLK4 OS=Xenopus laevis GN=plk4 PE=2 SV=1 18 231 2.0E-26
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 13 268 2.0E-26
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 16 268 2.0E-26
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 14 268 2.0E-26
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 10 268 2.0E-26
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 16 268 2.0E-26
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 16 268 3.0E-26
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 11 268 3.0E-26
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 16 275 4.0E-26
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 14 222 4.0E-26
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 24 268 5.0E-26
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 16 222 5.0E-26
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 24 268 6.0E-26
sp|O74426|PPK33_SCHPO Serine/threonine-protein kinase ppk33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk33 PE=3 SV=1 16 320 6.0E-26
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 14 269 7.0E-26
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 24 268 7.0E-26
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 16 271 8.0E-26
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 16 222 8.0E-26
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 16 268 9.0E-26
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 14 281 9.0E-26
sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 18 272 1.0E-25
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 16 222 2.0E-25
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 16 222 2.0E-25
sp|Q9LYQ8|CIPK2_ARATH CBL-interacting serine/threonine-protein kinase 2 OS=Arabidopsis thaliana GN=CIPK2 PE=1 SV=1 13 222 2.0E-25
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 16 222 2.0E-25
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 14 229 2.0E-25
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 16 268 2.0E-25
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 24 268 2.0E-25
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 14 281 2.0E-25
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 14 281 3.0E-25
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 2 224 3.0E-25
sp|P51952|CDK7_RAT Cyclin-dependent kinase 7 (Fragment) OS=Rattus norvegicus GN=Cdk7 PE=1 SV=2 17 229 3.0E-25
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 18 268 3.0E-25
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 16 268 3.0E-25
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 2 224 3.0E-25
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 24 268 3.0E-25
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 24 268 3.0E-25
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 16 272 4.0E-25
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 24 268 4.0E-25
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 16 222 4.0E-25
sp|Q8CEE6|PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus GN=Pask PE=1 SV=3 15 222 4.0E-25
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 16 222 4.0E-25
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 18 268 4.0E-25
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 9 268 5.0E-25
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 24 268 5.0E-25
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 2 224 6.0E-25
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 18 268 6.0E-25
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 18 222 6.0E-25
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 6 268 6.0E-25
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 18 226 7.0E-25
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 16 222 7.0E-25
sp|A6ZU08|TOS3_YEAS7 Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain YJM789) GN=TOS3 PE=3 SV=1 18 222 7.0E-25
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 24 273 7.0E-25
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 16 222 8.0E-25
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 16 222 8.0E-25
sp|P43637|TOS3_YEAST Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOS3 PE=1 SV=1 18 222 8.0E-25
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 16 222 8.0E-25
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 16 275 8.0E-25
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 14 272 9.0E-25
sp|O88831|KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus GN=Camkk2 PE=1 SV=1 17 271 9.0E-25
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 16 271 9.0E-25
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 24 279 9.0E-25
sp|O60307|MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens GN=MAST3 PE=1 SV=2 18 268 1.0E-24
sp|Q3U214|MAST3_MOUSE Microtubule-associated serine/threonine-protein kinase 3 OS=Mus musculus GN=Mast3 PE=1 SV=3 18 268 1.0E-24
sp|Q03147|CDK7_MOUSE Cyclin-dependent kinase 7 OS=Mus musculus GN=Cdk7 PE=1 SV=2 17 229 1.0E-24
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 16 222 1.0E-24
sp|Q96RR4|KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens GN=CAMKK2 PE=1 SV=2 17 271 1.0E-24
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 14 291 1.0E-24
sp|P50613|CDK7_HUMAN Cyclin-dependent kinase 7 OS=Homo sapiens GN=CDK7 PE=1 SV=1 17 229 1.0E-24
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 10 268 1.0E-24
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 10 268 2.0E-24
sp|P43057|KPC1_CANAX Protein kinase C-like 1 OS=Candida albicans GN=PKC1 PE=3 SV=1 18 276 2.0E-24
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 14 222 2.0E-24
sp|Q39192|SRK2D_ARATH Serine/threonine-protein kinase SRK2D OS=Arabidopsis thaliana GN=SRK2D PE=1 SV=1 17 272 2.0E-24
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 16 268 2.0E-24
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 14 229 2.0E-24
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 16 275 2.0E-24
sp|Q9LZW4|CIPKE_ARATH CBL-interacting serine/threonine-protein kinase 14 OS=Arabidopsis thaliana GN=CIPK14 PE=1 SV=1 14 245 2.0E-24
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 16 275 2.0E-24
sp|O42632|KPC1_COCHE Protein kinase C-like OS=Cochliobolus heterostrophus GN=PKC1 PE=3 SV=1 18 268 2.0E-24
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 10 268 2.0E-24
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 24 232 2.0E-24
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 24 319 2.0E-24
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 23 268 2.0E-24
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 11 272 2.0E-24
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 2 311 2.0E-24
sp|P24583|KPC1_YEAST Protein kinase C-like 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKC1 PE=1 SV=3 12 348 2.0E-24
sp|Q6AX33|MAST3_XENLA Microtubule-associated serine/threonine-protein kinase 3 OS=Xenopus laevis GN=mast3 PE=2 SV=1 18 227 3.0E-24
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 9 268 3.0E-24
sp|Q03785|VHS1_YEAST Serine/threonine-protein kinase VHS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHS1 PE=1 SV=1 16 286 3.0E-24
sp|Q60592|MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus GN=Mast2 PE=1 SV=1 18 222 3.0E-24
sp|Q9CEF5|PKNB_LACLA Probable serine/threonine-protein kinase PknB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pknB PE=3 SV=1 9 268 4.0E-24
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 11 226 4.0E-24
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 18 268 4.0E-24
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 42 268 4.0E-24
sp|Q99014|KPC1_HYPJE Protein kinase C-like OS=Hypocrea jecorina GN=pkc1 PE=3 SV=1 18 268 4.0E-24
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 16 268 5.0E-24
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 18 268 5.0E-24
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 24 268 5.0E-24
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 23 268 5.0E-24
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 18 222 5.0E-24
sp|Q7ZVS3|PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio GN=plk4 PE=2 SV=2 18 226 5.0E-24
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 10 253 5.0E-24
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 24 268 5.0E-24
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 27 277 6.0E-24
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 24 222 6.0E-24
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 16 222 6.0E-24
sp|Q5UQ78|YR517_MIMIV Putative serine/threonine-protein kinase R517/R518 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R517 PE=3 SV=2 13 268 6.0E-24
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 18 268 6.0E-24
sp|P25333|HAL4_YEAST Serine/threonine-protein kinase HAL4/SAT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAT4 PE=1 SV=1 2 240 6.0E-24
sp|Q9LMT0|CDKD3_ARATH Cyclin-dependent kinase D-3 OS=Arabidopsis thaliana GN=CDKD-3 PE=1 SV=1 17 277 7.0E-24
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 18 276 7.0E-24
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 16 268 8.0E-24
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 24 319 8.0E-24
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 7 268 8.0E-24
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 16 268 9.0E-24
sp|Q8SW31|KIN1_ENCCU Probable serine/threonine-protein kinase KIN1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=KIN1 PE=3 SV=1 16 222 9.0E-24
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 14 222 9.0E-24
sp|Q6P0Q8|MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens GN=MAST2 PE=1 SV=2 18 227 9.0E-24
sp|P87253|KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06544 PE=3 SV=2 18 268 1.0E-23
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 17 268 1.0E-23
sp|Q811L6|MAST4_MOUSE Microtubule-associated serine/threonine-protein kinase 4 OS=Mus musculus GN=Mast4 PE=1 SV=3 18 268 1.0E-23
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 18 228 1.0E-23
sp|Q00078|KPC1_ASPNG Protein kinase C-like OS=Aspergillus niger GN=pkcA PE=3 SV=1 18 268 1.0E-23
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 16 271 1.0E-23
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 16 271 1.0E-23
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 16 271 1.0E-23
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 16 271 1.0E-23
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 16 271 2.0E-23
sp|Q9ZUZ2|CAMK3_ARATH CDPK-related kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=1 SV=1 6 268 2.0E-23
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 24 268 2.0E-23
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 18 271 2.0E-23
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 16 268 2.0E-23
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 24 222 2.0E-23
sp|A0JLX3|SMK4A_MOUSE Sperm motility kinase 4A OS=Mus musculus GN=Smok4a PE=2 SV=2 16 212 2.0E-23
sp|Q8C078|KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus GN=Camkk2 PE=1 SV=2 64 271 2.0E-23
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 24 268 2.0E-23
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 24 268 2.0E-23
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 23 268 2.0E-23
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 24 236 2.0E-23
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 14 271 2.0E-23
sp|Q84SN3|CDKF3_ORYSJ Cyclin-dependent kinase F-3 OS=Oryza sativa subsp. japonica GN=CDKF-3 PE=2 SV=1 17 334 2.0E-23
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 23 268 3.0E-23
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 16 268 3.0E-23
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 16 268 3.0E-23
sp|P36583|PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck2 PE=1 SV=2 18 268 3.0E-23
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 13 268 3.0E-23
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 14 268 3.0E-23
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 14 268 3.0E-23
sp|O15021|MAST4_HUMAN Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens GN=MAST4 PE=1 SV=3 18 222 3.0E-23
sp|Q9Y2H9|MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens GN=MAST1 PE=1 SV=2 18 222 3.0E-23
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 23 268 3.0E-23
sp|Q810W7|MAST1_RAT Microtubule-associated serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mast1 PE=1 SV=1 18 222 3.0E-23
sp|Q9R1L5|MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus GN=Mast1 PE=1 SV=3 18 222 3.0E-23
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 16 268 3.0E-23
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 23 290 4.0E-23
sp|P53233|FMP48_YEAST Probable serine/threonine-protein kinase FMP48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP48 PE=1 SV=1 18 217 4.0E-23
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 5 222 4.0E-23
sp|Q20845|PLK3_CAEEL Serine/threonine-protein kinase plk-3 OS=Caenorhabditis elegans GN=plk-3 PE=2 SV=1 24 222 4.0E-23
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 16 222 4.0E-23
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 17 281 4.0E-23
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 14 268 4.0E-23
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 17 222 5.0E-23
sp|Q5KQF5|CIPKM_ORYSJ CBL-interacting protein kinase 22 OS=Oryza sativa subsp. japonica GN=CIPK22 PE=2 SV=1 13 272 5.0E-23
sp|Q39193|SRK2I_ARATH Serine/threonine-protein kinase SRK2I OS=Arabidopsis thaliana GN=SRK2I PE=1 SV=1 17 263 5.0E-23
sp|Q8VBY2|KKCC1_MOUSE Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus GN=Camkk1 PE=1 SV=1 17 268 5.0E-23
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 23 229 5.0E-23
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 27 273 6.0E-23
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 2 268 6.0E-23
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 18 268 6.0E-23
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 9 222 6.0E-23
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 18 268 6.0E-23
sp|Q12505|SKS1_YEAST Serine/threonine-protein kinase SKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKS1 PE=1 SV=1 14 268 6.0E-23
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 4 274 8.0E-23
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 24 228 8.0E-23
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 18 224 8.0E-23
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 16 232 8.0E-23
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 24 268 9.0E-23
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 24 228 9.0E-23
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 18 276 9.0E-23
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 24 268 9.0E-23
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 14 226 1.0E-22
sp|P20911|CDK7_XENLA Cyclin-dependent kinase 7 OS=Xenopus laevis GN=cdk7 PE=1 SV=1 17 229 1.0E-22
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 9 222 1.0E-22
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 17 268 1.0E-22
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 16 268 1.0E-22
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 24 268 1.0E-22
sp|P49187|MK10_RAT Mitogen-activated protein kinase 10 OS=Rattus norvegicus GN=Mapk10 PE=1 SV=2 17 213 1.0E-22
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 24 247 1.0E-22
sp|P0C198|CHK1_USTMA Serine/threonine-protein kinase CHK1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHK1 PE=3 SV=1 96 275 1.0E-22
sp|Q8N5S9|KKCC1_HUMAN Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens GN=CAMKK1 PE=1 SV=2 17 268 1.0E-22
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 18 224 1.0E-22
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 70 222 1.0E-22
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 23 229 1.0E-22
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 17 268 1.0E-22
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 17 268 1.0E-22
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 18 268 2.0E-22
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 18 224 2.0E-22
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 16 222 2.0E-22
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 14 271 2.0E-22
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 18 224 2.0E-22
sp|A2KF29|SMKTR_MOUSE Sperm motility kinase Tcr mutant form OS=Mus musculus GN=Smoktcr PE=2 SV=1 16 224 2.0E-22
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 5 222 2.0E-22
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 18 268 2.0E-22
sp|P54734|PKNA_NOSS1 Serine/threonine-protein kinase PknA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pknA PE=3 SV=2 13 221 2.0E-22
sp|P34208|CHK1_SCHPO Serine/threonine-protein kinase chk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chk1 PE=1 SV=2 27 268 2.0E-22
sp|Q940H6|SRK2E_ARATH Serine/threonine-protein kinase SRK2E OS=Arabidopsis thaliana GN=SRK2E PE=1 SV=1 17 227 2.0E-22
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 23 268 2.0E-22
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 18 224 2.0E-22
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 18 232 2.0E-22
sp|P97756|KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus GN=Camkk1 PE=1 SV=1 56 268 2.0E-22
sp|P50526|SSP1_SCHPO Serine/threonine-protein kinase ssp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp1 PE=1 SV=1 6 268 2.0E-22
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 12 253 2.0E-22
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 24 278 2.0E-22
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 14 271 2.0E-22
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 4 227 2.0E-22
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 16 277 3.0E-22
sp|P38147|CHK1_YEAST Serine/threonine-protein kinase CHK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHK1 PE=1 SV=1 60 292 3.0E-22
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 18 222 3.0E-22
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 24 232 3.0E-22
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 11 316 3.0E-22
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 6 222 3.0E-22
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 3 228 3.0E-22
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 24 232 3.0E-22
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 18 272 3.0E-22
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 18 222 3.0E-22
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 18 279 3.0E-22
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 18 251 3.0E-22
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 17 222 3.0E-22
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 18 224 4.0E-22
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 11 276 4.0E-22
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 24 268 4.0E-22
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 4 268 4.0E-22
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 18 224 4.0E-22
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 18 252 4.0E-22
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 16 268 4.0E-22
sp|P33973|PKN1_MYXXA Serine/threonine-protein kinase Pkn1 OS=Myxococcus xanthus GN=pkn1 PE=1 SV=1 5 277 4.0E-22
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 16 268 4.0E-22
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 14 222 4.0E-22
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 17 229 4.0E-22
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 23 268 5.0E-22
sp|Q61831|MK10_MOUSE Mitogen-activated protein kinase 10 OS=Mus musculus GN=Mapk10 PE=1 SV=2 17 213 5.0E-22
sp|P38991|IPL1_YEAST Spindle assembly checkpoint kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPL1 PE=1 SV=1 79 272 5.0E-22
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 16 232 5.0E-22
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 47 273 5.0E-22
sp|P0C5D6|SAPK3_ORYSJ Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. japonica GN=SAPK3 PE=1 SV=1 14 271 5.0E-22
sp|A2ZAB5|SAPK3_ORYSI Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. indica GN=SAPK3 PE=1 SV=2 14 271 5.0E-22
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 24 271 5.0E-22
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 23 222 5.0E-22
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 24 268 5.0E-22
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 18 237 5.0E-22
sp|Q96RG2|PASK_HUMAN PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens GN=PASK PE=1 SV=3 17 223 5.0E-22
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 11 222 5.0E-22
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 18 222 6.0E-22
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 24 253 6.0E-22
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 24 277 6.0E-22
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 17 222 6.0E-22
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 23 229 7.0E-22
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 18 222 7.0E-22
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 18 277 7.0E-22
sp|A2YNT8|SAPK2_ORYSI Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. indica GN=SAPK2 PE=2 SV=2 17 227 7.0E-22
sp|O64812|SRK2J_ARATH Serine/threonine-protein kinase SRK2J OS=Arabidopsis thaliana GN=SRK2J PE=1 SV=1 17 269 7.0E-22
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 18 268 7.0E-22
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 24 228 7.0E-22
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 4 268 7.0E-22
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 18 268 7.0E-22
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 14 268 7.0E-22
sp|O55092|SLK_CAVPO STE20-like serine/threonine-protein kinase OS=Cavia porcellus GN=SLK PE=1 SV=1 18 215 7.0E-22
sp|P53779|MK10_HUMAN Mitogen-activated protein kinase 10 OS=Homo sapiens GN=MAPK10 PE=1 SV=2 17 213 8.0E-22
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 16 232 8.0E-22
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 18 277 8.0E-22
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 24 268 8.0E-22
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 17 222 9.0E-22
sp|Q0D4J7|SAPK2_ORYSJ Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. japonica GN=SAPK2 PE=1 SV=1 17 227 9.0E-22
sp|Q75LR7|SAPK1_ORYSJ Serine/threonine-protein kinase SAPK1 OS=Oryza sativa subsp. japonica GN=SAPK1 PE=1 SV=1 17 225 9.0E-22
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 17 243 9.0E-22
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 11 222 1.0E-21
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 11 222 1.0E-21
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 16 231 1.0E-21
sp|P30285|CDK4_MOUSE Cyclin-dependent kinase 4 OS=Mus musculus GN=Cdk4 PE=1 SV=1 17 277 1.0E-21
sp|Q62726|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1 16 232 1.0E-21
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 21 272 1.0E-21
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 17 222 1.0E-21
sp|Q8WU08|ST32A_HUMAN Serine/threonine-protein kinase 32A OS=Homo sapiens GN=STK32A PE=1 SV=2 18 222 1.0E-21
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 17 222 1.0E-21
sp|P35426|CDK4_RAT Cyclin-dependent kinase 4 OS=Rattus norvegicus GN=Cdk4 PE=1 SV=1 17 277 1.0E-21
sp|Q9S2C0|PKSC_STRCO Serine/threonine-protein kinase PksC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pksC PE=3 SV=1 7 341 1.0E-21
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 17 271 1.0E-21
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 18 277 1.0E-21
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 24 275 1.0E-21
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 16 271 1.0E-21
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 19 229 1.0E-21
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 23 268 1.0E-21
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 16 271 1.0E-21
sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 18 231 1.0E-21
sp|P54736|PKN2_MYXXA Serine/threonine-protein kinase pkn2 OS=Myxococcus xanthus GN=pkn2 PE=3 SV=1 12 225 1.0E-21
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 16 271 1.0E-21
sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 18 231 1.0E-21
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 17 222 1.0E-21
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 18 277 1.0E-21
sp|Q9SJ61|CDPKP_ARATH Calcium-dependent protein kinase 25 OS=Arabidopsis thaliana GN=CPK25 PE=2 SV=1 18 268 1.0E-21
sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 18 231 1.0E-21
sp|O35280|CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=1 SV=2 18 242 1.0E-21
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 16 222 1.0E-21
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 18 232 1.0E-21
sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 18 231 1.0E-21
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 24 222 2.0E-21
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 24 222 2.0E-21
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 24 222 2.0E-21
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 3 222 2.0E-21
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 17 224 2.0E-21
sp|Q9DGD9|MK08_DANRE Mitogen-activated protein kinase 8 OS=Danio rerio GN=mapk8 PE=2 SV=1 17 213 2.0E-21
sp|Q07832|PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus GN=Plk1 PE=1 SV=2 24 271 2.0E-21
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 66 288 2.0E-21
sp|Q8AYC9|CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus GN=CHEK1 PE=1 SV=1 18 242 2.0E-21
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 17 222 2.0E-21
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 14 268 2.0E-21
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 9 268 2.0E-21
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 18 268 2.0E-21
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 24 222 2.0E-21
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 18 277 2.0E-21
sp|Q40532|NTF4_TOBAC Mitogen-activated protein kinase homolog NTF4 OS=Nicotiana tabacum GN=NTF4 PE=2 SV=1 21 271 2.0E-21
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 14 222 2.0E-21
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 18 261 2.0E-21
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 17 222 2.0E-21
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 17 222 2.0E-21
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 16 269 2.0E-21
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 6 222 2.0E-21
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 27 232 2.0E-21
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 14 222 2.0E-21
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 18 215 2.0E-21
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 7 268 2.0E-21
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 17 222 2.0E-21
sp|Q75H77|SAPKA_ORYSJ Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1 12 227 2.0E-21
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 27 232 2.0E-21
sp|Q54E34|Y6398_DICDI Probable protein kinase DDB_G0291842 OS=Dictyostelium discoideum GN=DDB_G0291842 PE=3 SV=1 18 271 2.0E-21
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 27 232 2.0E-21
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 17 229 2.0E-21
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 18 224 3.0E-21
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 16 222 3.0E-21
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 66 268 3.0E-21
sp|Q9M9V8|CDPKA_ARATH Calcium-dependent protein kinase 10 OS=Arabidopsis thaliana GN=CPK10 PE=1 SV=1 24 268 3.0E-21
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 11 269 3.0E-21
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 18 242 3.0E-21
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 18 268 3.0E-21
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 18 268 3.0E-21
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 18 215 3.0E-21
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 24 268 3.0E-21
sp|Q7XQP4|SAPK7_ORYSJ Serine/threonine-protein kinase SAPK7 OS=Oryza sativa subsp. japonica GN=SAPK7 PE=2 SV=2 17 271 3.0E-21
sp|Q9U1Y5|CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans GN=chk-2 PE=2 SV=2 14 268 3.0E-21
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 9 268 3.0E-21
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 24 222 3.0E-21
sp|Q9SSF8|CDPKU_ARATH Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 24 238 3.0E-21
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 18 249 3.0E-21
sp|Q9C9M7|CDKD2_ARATH Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana GN=CDKD-2 PE=1 SV=1 17 271 3.0E-21
sp|Q9H2G2|SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens GN=SLK PE=1 SV=1 18 215 3.0E-21
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 27 232 3.0E-21
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 23 229 3.0E-21
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 17 268 3.0E-21
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 18 268 3.0E-21
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 18 277 4.0E-21
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 24 222 4.0E-21
sp|Q8IVW4|CDKL3_HUMAN Cyclin-dependent kinase-like 3 OS=Homo sapiens GN=CDKL3 PE=1 SV=1 18 229 4.0E-21
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 18 224 4.0E-21
sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 19 231 4.0E-21
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 14 268 4.0E-21
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 14 268 4.0E-21
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 24 227 4.0E-21
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 18 224 4.0E-21
sp|Q2TA25|PLK1_BOVIN Serine/threonine-protein kinase PLK1 OS=Bos taurus GN=PLK1 PE=2 SV=2 24 271 4.0E-21
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 7 223 4.0E-21
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 17 224 4.0E-21
sp|Q4R8T9|CDKL3_MACFA Cyclin-dependent kinase-like 3 OS=Macaca fascicularis GN=CDKL3 PE=2 SV=1 18 229 4.0E-21
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 18 222 4.0E-21
sp|P49185|MK08_RAT Mitogen-activated protein kinase 8 OS=Rattus norvegicus GN=Mapk8 PE=1 SV=1 17 217 4.0E-21
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 16 268 5.0E-21
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 17 224 5.0E-21
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 27 232 5.0E-21
sp|Q55FJ6|Y8078_DICDI Probable serine/threonine-protein kinase DDB_G0268078 OS=Dictyostelium discoideum GN=DDB_G0268078 PE=3 SV=1 17 268 5.0E-21
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 14 268 5.0E-21
sp|Q9WTU6|MK09_MOUSE Mitogen-activated protein kinase 9 OS=Mus musculus GN=Mapk9 PE=1 SV=2 17 222 5.0E-21
sp|Q91ZN7|CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1 18 242 5.0E-21
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 18 268 5.0E-21
sp|Q62673|PLK1_RAT Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus GN=Plk1 PE=2 SV=2 68 271 5.0E-21
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 24 268 5.0E-21
sp|Q8SSA8|CHK1_ENCCU Probable serine/threonine-protein kinase CHK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CHK1 PE=3 SV=1 43 232 5.0E-21
sp|A8WUG4|KPC3_CAEBR Protein kinase C-like 3 OS=Caenorhabditis briggsae GN=pkc-3 PE=3 SV=1 18 222 5.0E-21
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 17 222 5.0E-21
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 27 222 5.0E-21
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 17 222 6.0E-21
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 16 268 6.0E-21
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 17 224 6.0E-21
sp|P53350|PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens GN=PLK1 PE=1 SV=1 24 272 6.0E-21
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 17 224 6.0E-21
sp|Q9JM01|CDKL3_RAT Cyclin-dependent kinase-like 3 OS=Rattus norvegicus GN=Cdkl3 PE=2 SV=2 18 229 6.0E-21
sp|O88764|DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus GN=Dapk3 PE=1 SV=1 18 272 6.0E-21
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 14 222 6.0E-21
sp|O54784|DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus GN=Dapk3 PE=1 SV=1 18 272 6.0E-21
sp|Q3UTQ8|CDKL5_MOUSE Cyclin-dependent kinase-like 5 OS=Mus musculus GN=Cdkl5 PE=1 SV=1 4 294 6.0E-21
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 24 269 6.0E-21
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 18 268 7.0E-21
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 24 287 7.0E-21
sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 24 268 7.0E-21
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 18 278 7.0E-21
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 18 277 7.0E-21
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 14 268 7.0E-21
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 54 229 7.0E-21
sp|P54685|CDK7_DICDI Cyclin-dependent kinase 7 OS=Dictyostelium discoideum GN=cdk7 PE=2 SV=2 17 268 7.0E-21
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 24 268 8.0E-21
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 18 222 8.0E-21
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 24 268 8.0E-21
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 24 232 8.0E-21
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 16 224 9.0E-21
sp|Q5HZ38|GRIK2_ARATH Serine/threonine-protein kinase GRIK2 OS=Arabidopsis thaliana GN=GRIK2 PE=1 SV=1 18 229 9.0E-21
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 18 268 9.0E-21
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 17 222 9.0E-21
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 18 277 2.0E-18
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 44 227 2.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6583
MECMRDKFVGGVLLDGRYQTISPLNHGSFGMVFMAQDLVTDQPVAIKCLTKQSAHGEAGLDLAVDDKSEEMVLHR
SLGSHANIVNLLNSFETESHVYLVMEFCSQGDLYEAIRNGHGPLQTEHVRQFMLQLVDAVEYIHAKGIYHRDIKP
ENIFLTHDGAMKLGDFGLATKDKWSFEMTVGSDRYMAPEQFDSAGAGYSPAAADIWAIGICLLNILFSRNPFTTP
TEADPLFLDYSRDKQSLFDVFPAMSQDTYEVIVECMSLDPKRRSLVGARRALLRVLSFTMEDEPLDDFCGAEKTT
IATANREPLRTPSLQSPYVETGCAFPWAKALHASPHRYGRQLSVIPDDESYSEDLFSKSGETADWCTTSVQTPSM
SSVLGTHFGASMRSLAVHDTSRNQKVPPATGSLPIAMAKPLALSMSTVFGRRGNSVSKSWSDMWDEDEEEEREQQ
DPHLKELNARTWSHESRDDGKKAVPTEAESSHDIKGDVDEDLVADGFFFQEAPTPQKPSSATPRYSPPSKRFNYD
KWAALGERRRAQGFSLESDKSPGSKPRRQIGFGYRSYEAGVLEHSFNNYHHNHQINAGKAWGGKEKPKDCYWAKG
RDWNWRRERRSDLGEVEWVGGW*
Coding >Hirsu2|6583
ATGGAATGCATGAGGGACAAGTTCGTCGGTGGCGTCCTTCTCGATGGCCGCTATCAGACAATTTCGCCCCTCAAC
CACGGGTCCTTTGGCATGGTCTTTATGGCCCAGGACCTGGTGACTGACCAGCCCGTGGCCATCAAGTGCCTGACG
AAGCAATCTGCTCATGGTGAGGCTGGACTGGATCTCGCCGTCGACGACAAGTCCGAGGAAATGGTGCTTCACCGC
AGCCTGGGCTCCCACGCGAATATCGTTAATCTTCTCAACTCGTTCGAGACGGAGTCGCACGTCTACCTCGTCATG
GAATTCTGCTCTCAGGGCGACTTGTACGAGGCCATTCGCAACGGCCACGGGCCCCTCCAGACCGAACATGTCCGT
CAATTTATGCTTCAGCTTGTGGATGCCGTCGAGTACATCCACGCCAAGGGCATCTACCACCGCGACATCAAGCCG
GAAAACATCTTCCTCACCCATGACGGAGCGATGAAGCTGGGCGACTTCGGGCTGGCGACAAAGGACAAGTGGTCT
TTCGAGATGACGGTGGGAAGCGATCGCTACATGGCCCCAGAACAATTCGACTCCGCCGGCGCCGGTTACTCGCCC
GCGGCCGCCGACATCTGGGCCATCGGCATCTGCCTTCTCAACATCCTCTTCTCGCGGAACCCGTTCACCACCCCA
ACTGAAGCTGACCCCCTGTTTCTTGACTACTCTCGCGACAAGCAGAGTCTCTTCGACGTGTTTCCGGCTATGTCG
CAAGACACCTACGAGGTCATCGTCGAATGTATGAGTCTGGATCCCAAGCGGCGATCTCTGGTTGGGGCTCGACGT
GCACTCCTTCGCGTTCTCAGCTTCACCATGGAGGACGAGCCTCTCGACGACTTTTGCGGCGCCGAGAAGACAACC
ATCGCCACTGCCAACAGGGAGCCACTGCGCACACCGTCTCTCCAGAGCCCCTACGTGGAGACGGGCTGCGCGTTC
CCATGGGCGAAGGCGCTGCATGCGAGCCCTCACCGCTACGGCCGCCAGCTCAGTGTCATTCCTGACGACGAGTCG
TACTCCGAGGACCTCTTCTCCAAGTCCGGGGAGACGGCCGATTGGTGCACCACTAGCGTCCAAACACCGTCAATG
TCGTCTGTTCTCGGAACCCACTTCGGGGCCTCGATGCGATCTCTGGCTGTACACGACACCTCCCGCAACCAAAAG
GTTCCGCCCGCGACAGGTTCACTGCCCATTGCCATGGCGAAGCCCCTCGCCCTGTCCATGTCGACCGTCTTCGGC
CGCCGGGGAAACTCGGTCTCCAAGAGCTGGAGCGACATGTGGGATGAGGACGAGGAGGAGGAACGTGAACAGCAA
GACCCGCACCTCAAGGAGCTCAATGCGAGGACTTGGAGCCACGAGAGCCGCGACGATGGCAAGAAGGCGGTGCCG
ACCGAGGCCGAGTCGTCGCATGACATCAAAGGGGATGTCGACGAAGACCTGGTGGCGGACGGATTCTTCTTTCAG
GAAGCGCCCACACCCCAGAAACCTTCGTCTGCAACCCCTCGCTACTCGCCGCCGTCCAAGCGTTTCAACTACGAC
AAGTGGGCTGCGCTGGGCGAGCGTCGCAGGGCGCAGGGGTTCTCATTGGAAAGCGACAAGTCGCCGGGCTCGAAG
CCTCGTCGACAAATTGGCTTTGGGTACAGATCTTATGAAGCGGGCGTTTTGGAACATTCTTTCAACAATTATCAT
CATAACCATCAAATCAACGCAGGCAAAGCCTGGGGAGGCAAGGAGAAGCCCAAGGACTGTTACTGGGCAAAGGGC
AGAGATTGGAACTGGCGCCGGGAGCGGCGCTCCGATCTTGGTGAAGTTGAGTGGGTTGGGGGGTGGTAG
Transcript >Hirsu2|6583
ATGGAATGCATGAGGGACAAGTTCGTCGGTGGCGTCCTTCTCGATGGCCGCTATCAGACAATTTCGCCCCTCAAC
CACGGGTCCTTTGGCATGGTCTTTATGGCCCAGGACCTGGTGACTGACCAGCCCGTGGCCATCAAGTGCCTGACG
AAGCAATCTGCTCATGGTGAGGCTGGACTGGATCTCGCCGTCGACGACAAGTCCGAGGAAATGGTGCTTCACCGC
AGCCTGGGCTCCCACGCGAATATCGTTAATCTTCTCAACTCGTTCGAGACGGAGTCGCACGTCTACCTCGTCATG
GAATTCTGCTCTCAGGGCGACTTGTACGAGGCCATTCGCAACGGCCACGGGCCCCTCCAGACCGAACATGTCCGT
CAATTTATGCTTCAGCTTGTGGATGCCGTCGAGTACATCCACGCCAAGGGCATCTACCACCGCGACATCAAGCCG
GAAAACATCTTCCTCACCCATGACGGAGCGATGAAGCTGGGCGACTTCGGGCTGGCGACAAAGGACAAGTGGTCT
TTCGAGATGACGGTGGGAAGCGATCGCTACATGGCCCCAGAACAATTCGACTCCGCCGGCGCCGGTTACTCGCCC
GCGGCCGCCGACATCTGGGCCATCGGCATCTGCCTTCTCAACATCCTCTTCTCGCGGAACCCGTTCACCACCCCA
ACTGAAGCTGACCCCCTGTTTCTTGACTACTCTCGCGACAAGCAGAGTCTCTTCGACGTGTTTCCGGCTATGTCG
CAAGACACCTACGAGGTCATCGTCGAATGTATGAGTCTGGATCCCAAGCGGCGATCTCTGGTTGGGGCTCGACGT
GCACTCCTTCGCGTTCTCAGCTTCACCATGGAGGACGAGCCTCTCGACGACTTTTGCGGCGCCGAGAAGACAACC
ATCGCCACTGCCAACAGGGAGCCACTGCGCACACCGTCTCTCCAGAGCCCCTACGTGGAGACGGGCTGCGCGTTC
CCATGGGCGAAGGCGCTGCATGCGAGCCCTCACCGCTACGGCCGCCAGCTCAGTGTCATTCCTGACGACGAGTCG
TACTCCGAGGACCTCTTCTCCAAGTCCGGGGAGACGGCCGATTGGTGCACCACTAGCGTCCAAACACCGTCAATG
TCGTCTGTTCTCGGAACCCACTTCGGGGCCTCGATGCGATCTCTGGCTGTACACGACACCTCCCGCAACCAAAAG
GTTCCGCCCGCGACAGGTTCACTGCCCATTGCCATGGCGAAGCCCCTCGCCCTGTCCATGTCGACCGTCTTCGGC
CGCCGGGGAAACTCGGTCTCCAAGAGCTGGAGCGACATGTGGGATGAGGACGAGGAGGAGGAACGTGAACAGCAA
GACCCGCACCTCAAGGAGCTCAATGCGAGGACTTGGAGCCACGAGAGCCGCGACGATGGCAAGAAGGCGGTGCCG
ACCGAGGCCGAGTCGTCGCATGACATCAAAGGGGATGTCGACGAAGACCTGGTGGCGGACGGATTCTTCTTTCAG
GAAGCGCCCACACCCCAGAAACCTTCGTCTGCAACCCCTCGCTACTCGCCGCCGTCCAAGCGTTTCAACTACGAC
AAGTGGGCTGCGCTGGGCGAGCGTCGCAGGGCGCAGGGGTTCTCATTGGAAAGCGACAAGTCGCCGGGCTCGAAG
CCTCGTCGACAAATTGGCTTTGGGTACAGATCTTATGAAGCGGGCGTTTTGGAACATTCTTTCAACAATTATCAT
CATAACCATCAAATCAACGCAGGCAAAGCCTGGGGAGGCAAGGAGAAGCCCAAGGACTGTTACTGGGCAAAGGGC
AGAGATTGGAACTGGCGCCGGGAGCGGCGCTCCGATCTTGGTGAAGTTGAGTGGGTTGGGGGGTGGTAG
Gene >Hirsu2|6583
ATGGAATGCATGAGGGACAAGTTCGTCGGTGGCGTCCTTCTCGATGGCCGCTATCAGACAATTTCGCCCCTCAAC
CACGGGTCCTTTGGCATGGTCTTTATGGCCCAGGACCTGGTGACTGACCAGCCCGTGGCCATCAAGTGCCTGACG
AAGCAATCTGCTCATGGTGAGGCTGGACTGGATCTCGCCGTCGACGACAAGTCCGAGGAAATGGTGCTTCACCGC
AGCCTGGGCTCCCACGCGAATATCGTTAATCTTCTCAACTCGTTCGAGACGGAGTCGCACGTCTACCTCGTCATG
GAATTCTGCTCTCAGGGCGACTTGTACGAGGCCATTCGCAACGGCCACGGGCCCCTCCAGACCGAACATGTCCGT
CAATTTATGCTTCAGCTTGTGGATGCCGTCGAGTACATCCACGCCAAGGGCATCTACCACCGCGACATCAAGCCG
GAAAACATCTTCCTCACCCATGACGGAGCGATGAAGCTGGGCGACTTCGGGCTGGCGACAAAGGACAAGTGGTCT
TTCGAGATGACGGTGGGAAGCGATCGCTACATGGCCCCAGAACAATTCGACTCCGCCGGCGCCGGTTACTCGCCC
GCGGCCGCCGACATCTGGGCCATCGGCATCTGCCTTCTCAACATCCTCTTCTCGCGGAACCCGTTCACCACCCCA
ACTGAAGCTGACCCCCTGTTTCTTGACTACTCTCGCGACAAGCAGAGTCTCTTCGACGTGTTTCCGGCTATGTCG
CAAGACACCTACGAGGTCATCGTCGAATGTATGAGTCTGGATCCCAAGCGGCGATCTCTGGTTGGGGCTCGACGT
GCACTCCTTCGCGTTCTCAGCTTCACCATGGAGGACGAGCCTCTCGACGACTTTTGCGGCGCCGAGAAGACAACC
ATCGCCACTGCCAACAGGGAGCCACTGCGCACACCGTCTCTCCAGAGCCCCTACGTGGAGACGGGCTGCGCGTTC
CCATGGGCGAAGGCGCTGCATGCGAGCCCTCACCGCTACGGCCGCCAGCTCAGTGTCATTCCTGACGACGAGTCG
TACTCCGAGGACCTCTTCTCCAAGTCCGGGGAGACGGCCGATTGGTGCACCACTAGCGTCCAAACACCGTCAATG
TCGTCTGTTCTCGGAACCCACTTCGGGGCCTCGATGCGATCTCTGGCTGTACACGACACCTCCCGCAACCAAAAG
GTTCCGCCCGCGACAGGTTCACTGCCCATTGCCATGGCGAAGCCCCTCGCCCTGTCCATGTCGACCGTCTTCGGC
CGCCGGGGAAACTCGGTCTCCAAGAGCTGGAGCGACATGTGGGATGAGGACGAGGAGGAGGAACGTGAACAGCAA
GACCCGCACCTCAAGGAGCTCAATGCGAGGACTTGGAGCCACGAGAGCCGCGACGATGGCAAGAAGGCGGTGCCG
ACCGAGGCCGAGTCGTCGCATGACATCAAAGGGGATGTCGACGAAGACCTGGTGGCGGACGGATTCTTCTTTCAG
GAAGCGCCCACACCCCAGAAACCTTCGTCTGCAACCCCTCGCTACTCGCCGCCGTCCAAGCGTTTCAACTACGAC
AAGTGGGCTGCGCTGGGCGAGCGTCGCAGGGCGCAGGGGTTCTCATTGGAAAGCGACAAGTCGCCGGGCTCGAAG
CCTCGTCGACAAATTGGCTTTGGGTACAGATCTTATGAAGCGGGCGTTTTGGAACATTCTTTCAACAATTATCAT
CATAACCATCAAATCAACGCAGGCAAAGCCTGGGGAGGCAAGGAGAAGCCCAAGGACTGTTACTGGGCAAAGGGC
AGAGATTGGAACTGGCGCCGGGAGCGGCGCTCCGATCTTGGTGAAGTTGAGTGGGTTGGGGGGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail