Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6577
Gene name
LocationContig_340:13382..17045
Strand+
Gene length (bp)3663
Transcript length (bp)3339
Coding sequence length (bp)3339
Protein length (aa) 1113

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01412 ArfGap Putative GTPase activating protein for Arf 3.8E-32 832 947
PF16746 BAR_3 BAR domain of APPL family 3.8E-24 303 533
PF00169 PH PH domain 1.4E-10 660 747

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUE2|CSX2_SCHPO Protein csx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csx2 PE=1 SV=1 629 986 4.0E-63
sp|Q9UUE2|CSX2_SCHPO Protein csx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csx2 PE=1 SV=1 21 525 2.0E-59
sp|Q10165|CNT6_SCHPO Probable ribosylation factor GTPase-activating protein cnt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnt6 PE=1 SV=1 645 986 9.0E-53
sp|A5PK26|ACAP1_BOVIN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Bos taurus GN=ACAP1 PE=2 SV=1 657 946 2.0E-36
sp|Q15027|ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=ACAP1 PE=1 SV=1 657 946 5.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUE2|CSX2_SCHPO Protein csx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csx2 PE=1 SV=1 629 986 4.0E-63
sp|Q9UUE2|CSX2_SCHPO Protein csx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csx2 PE=1 SV=1 21 525 2.0E-59
sp|Q10165|CNT6_SCHPO Probable ribosylation factor GTPase-activating protein cnt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnt6 PE=1 SV=1 645 986 9.0E-53
sp|A5PK26|ACAP1_BOVIN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Bos taurus GN=ACAP1 PE=2 SV=1 657 946 2.0E-36
sp|Q15027|ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=ACAP1 PE=1 SV=1 657 946 5.0E-36
sp|Q8K2H4|ACAP1_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Acap1 PE=1 SV=1 657 949 3.0E-34
sp|Q5ZK62|ACAP2_CHICK Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Gallus gallus GN=ACAP2 PE=2 SV=1 657 947 5.0E-33
sp|Q6ZQK5|ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Acap2 PE=1 SV=2 657 954 1.0E-32
sp|Q5FVC7|ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus GN=Acap2 PE=1 SV=1 657 954 2.0E-32
sp|Q15057|ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=ACAP2 PE=1 SV=3 657 954 9.0E-32
sp|Q5W7F2|AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana GN=AGD3 PE=1 SV=1 300 946 1.0E-31
sp|Q6IVG4|ACAP2_RABIT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Oryctolagus cuniculus GN=ACAP2 PE=2 SV=1 657 954 4.0E-31
sp|Q96P50|ACAP3_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ACAP3 PE=1 SV=2 657 946 8.0E-30
sp|Q9FIT8|AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana GN=AGD1 PE=2 SV=2 303 946 1.0E-27
sp|Q9UPQ3|AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=AGAP1 PE=1 SV=4 832 967 5.0E-26
sp|Q9NGC3|CEG1A_DROME Centaurin-gamma-1A OS=Drosophila melanogaster GN=CenG1A PE=2 SV=2 835 1040 8.0E-26
sp|Q8BXK8|AGAP1_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Agap1 PE=1 SV=1 832 980 5.0E-25
sp|Q9C6C3|AGD2_ARATH ADP-ribosylation factor GTPase-activating protein AGD2 OS=Arabidopsis thaliana GN=AGD2 PE=2 SV=1 691 989 6.0E-25
sp|Q8VHH5|AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus GN=Agap3 PE=1 SV=1 832 980 2.0E-24
sp|Q99490|AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=AGAP2 PE=1 SV=2 832 980 2.0E-24
sp|Q96P64|AGAP4_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 4 OS=Homo sapiens GN=AGAP4 PE=2 SV=2 840 967 2.0E-24
sp|Q5VUJ5|AGAP7_HUMAN Putative Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 7 OS=Homo sapiens GN=AGAP7P PE=5 SV=1 840 967 4.0E-24
sp|Q6NRL1|AGAP1_XENLA Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Xenopus laevis GN=agap1 PE=2 SV=1 832 980 6.0E-24
sp|Q96P47|AGAP3_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=AGAP3 PE=1 SV=2 832 980 6.0E-24
sp|Q8TF27|AGA11_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 11 OS=Homo sapiens GN=AGAP11 PE=2 SV=2 840 967 7.0E-24
sp|Q5VW22|AGAP6_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 6 OS=Homo sapiens GN=AGAP6 PE=2 SV=1 840 967 1.0E-23
sp|Q04412|AGE1_YEAST ADP-ribosylation factor GTPase-activating protein effector protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGE1 PE=1 SV=1 788 980 2.0E-23
sp|A6NIR3|AGAP5_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 5 OS=Homo sapiens GN=AGAP5 PE=2 SV=2 840 967 3.0E-23
sp|A8MT82|CTLFB_HUMAN Putative centaurin-gamma-like family member 11P OS=Homo sapiens GN=CTGLF11P PE=5 SV=2 840 967 4.0E-23
sp|Q8CGU4|AGAP2_RAT Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus GN=Agap2 PE=1 SV=1 832 952 5.0E-23
sp|Q3UHD9|AGAP2_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Agap2 PE=1 SV=1 832 952 6.0E-23
sp|Q5VTM2|AGAP9_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 9 OS=Homo sapiens GN=AGAP9 PE=3 SV=2 840 967 9.0E-23
sp|Q8WZ64|ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=ARAP2 PE=1 SV=3 600 1011 2.0E-21
sp|Q8LFN9|AGD13_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD13 OS=Arabidopsis thaliana GN=AGD13 PE=2 SV=1 845 948 1.0E-20
sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD11 OS=Arabidopsis thaliana GN=AGD11 PE=2 SV=1 829 956 1.0E-20
sp|Q5U464|ASAP3_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 OS=Mus musculus GN=Asap3 PE=2 SV=1 697 1042 2.0E-20
sp|Q8BZ05|ARAP2_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Arap2 PE=1 SV=2 666 1011 8.0E-20
sp|Q9SMX5|AGD4_ARATH ADP-ribosylation factor GTPase-activating protein AGD4 OS=Arabidopsis thaliana GN=AGD4 PE=2 SV=2 693 989 9.0E-20
sp|Q9FVJ3|AGD12_ARATH ADP-ribosylation factor GTPase-activating protein AGD12 OS=Arabidopsis thaliana GN=AGD12 PE=1 SV=1 845 948 3.0E-19
sp|Q10165|CNT6_SCHPO Probable ribosylation factor GTPase-activating protein cnt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnt6 PE=1 SV=1 173 535 3.0E-19
sp|Q0WQQ1|AGD15_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD15 OS=Arabidopsis thaliana GN=AGD15 PE=2 SV=1 845 948 7.0E-18
sp|O43150|ASAP2_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=ASAP2 PE=1 SV=3 697 980 1.0E-17
sp|Q9UT34|YIQ9_SCHPO Uncharacterized protein C824.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC824.09c PE=3 SV=1 845 946 3.0E-17
sp|Q8WWN8|ARAP3_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ARAP3 PE=1 SV=1 838 948 3.0E-17
sp|Q8TDY4|ASAP3_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ASAP3 PE=1 SV=1 821 1042 3.0E-17
sp|Q7SIG6|ASAP2_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Asap2 PE=1 SV=3 697 980 4.0E-17
sp|Q9FL69|AGD5_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD5 OS=Arabidopsis thaliana GN=AGD5 PE=1 SV=1 845 946 4.0E-17
sp|Q9QWY8|ASAP1_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Asap1 PE=1 SV=2 841 1008 8.0E-17
sp|Q1AAU6|ASAP1_RAT Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Rattus norvegicus GN=Asap1 PE=1 SV=2 841 1008 8.0E-17
sp|Q9ULH1|ASAP1_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=ASAP1 PE=1 SV=4 841 1008 8.0E-17
sp|O97902|ASAP1_BOVIN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Bos taurus GN=ASAP1 PE=1 SV=1 841 1008 3.0E-16
sp|Q4LDD4|ARAP1_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Arap1 PE=1 SV=2 842 1093 5.0E-15
sp|Q96P48|ARAP1_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=ARAP1 PE=1 SV=3 842 1011 6.0E-15
sp|Q8R5G7|ARAP3_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Mus musculus GN=Arap3 PE=1 SV=3 845 948 9.0E-15
sp|O74345|UCP3_SCHPO UBA domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp3 PE=3 SV=1 835 955 1.0E-14
sp|P40529|AGE2_YEAST ADP-ribosylation factor GTPase-activating protein effector protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGE2 PE=1 SV=1 839 951 1.0E-13
sp|Q8IYB5|SMAP1_HUMAN Stromal membrane-associated protein 1 OS=Homo sapiens GN=SMAP1 PE=1 SV=2 831 917 5.0E-13
sp|Q91VZ6|SMAP1_MOUSE Stromal membrane-associated protein 1 OS=Mus musculus GN=Smap1 PE=1 SV=1 831 917 6.0E-13
sp|Q7TN29|SMAP2_MOUSE Stromal membrane-associated protein 2 OS=Mus musculus GN=Smap2 PE=1 SV=1 831 945 6.0E-13
sp|Q8WU79|SMAP2_HUMAN Stromal membrane-associated protein 2 OS=Homo sapiens GN=SMAP2 PE=1 SV=1 839 945 7.0E-13
sp|Q5EA00|SMAP2_BOVIN Stromal membrane-associated protein 2 OS=Bos taurus GN=SMAP2 PE=2 SV=1 831 945 9.0E-13
sp|Q9NPF8|ADAP2_HUMAN Arf-GAP with dual PH domain-containing protein 2 OS=Homo sapiens GN=ADAP2 PE=1 SV=1 822 946 2.0E-12
sp|Q9JLQ2|GIT2_MOUSE ARF GTPase-activating protein GIT2 OS=Mus musculus GN=Git2 PE=1 SV=2 845 1051 3.0E-12
sp|Q5F413|SMAP2_CHICK Stromal membrane-associated protein 2 OS=Gallus gallus GN=SMAP2 PE=2 SV=1 838 945 4.0E-12
sp|Q14161|GIT2_HUMAN ARF GTPase-activating protein GIT2 OS=Homo sapiens GN=GIT2 PE=1 SV=2 845 1051 5.0E-12
sp|Q9Y2X7|GIT1_HUMAN ARF GTPase-activating protein GIT1 OS=Homo sapiens GN=GIT1 PE=1 SV=2 845 1051 2.0E-11
sp|Q9Z272|GIT1_RAT ARF GTPase-activating protein GIT1 OS=Rattus norvegicus GN=Git1 PE=1 SV=1 845 1051 2.0E-11
sp|Q68FF6|GIT1_MOUSE ARF GTPase-activating protein GIT1 OS=Mus musculus GN=Git1 PE=1 SV=1 845 1051 2.0E-11
sp|Q62848|ARFG1_RAT ADP-ribosylation factor GTPase-activating protein 1 OS=Rattus norvegicus GN=Arfgap1 PE=1 SV=1 830 889 1.0E-10
sp|Q9EPJ9|ARFG1_MOUSE ADP-ribosylation factor GTPase-activating protein 1 OS=Mus musculus GN=Arfgap1 PE=1 SV=2 830 889 1.0E-10
sp|Q8R2V5|ADAP2_MOUSE Arf-GAP with dual PH domain-containing protein 2 OS=Mus musculus GN=Adap2 PE=1 SV=1 822 946 2.0E-10
sp|Q8N6T3|ARFG1_HUMAN ADP-ribosylation factor GTPase-activating protein 1 OS=Homo sapiens GN=ARFGAP1 PE=1 SV=2 830 889 3.0E-10
sp|Q9JK15|ADAP2_RAT Arf-GAP with dual PH domain-containing protein 2 OS=Rattus norvegicus GN=Adap2 PE=1 SV=1 822 946 4.0E-10
sp|O82171|AGD10_ARATH ADP-ribosylation factor GTPase-activating protein AGD10 OS=Arabidopsis thaliana GN=AGD10 PE=2 SV=1 837 914 3.0E-09
sp|Q99K28|ARFG2_MOUSE ADP-ribosylation factor GTPase-activating protein 2 OS=Mus musculus GN=Arfgap2 PE=1 SV=1 842 889 3.0E-09
sp|Q8H100|AGD8_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD8 OS=Arabidopsis thaliana GN=AGD8 PE=1 SV=1 842 953 3.0E-09
sp|Q3MID3|ARFG2_RAT ADP-ribosylation factor GTPase-activating protein 2 OS=Rattus norvegicus GN=Arfgap2 PE=1 SV=1 842 889 4.0E-09
sp|P38682|GLO3_YEAST ADP-ribosylation factor GTPase-activating protein GLO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO3 PE=1 SV=1 842 906 4.0E-09
sp|Q9FIQ0|AGD9_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD9 OS=Arabidopsis thaliana GN=AGD9 PE=1 SV=1 842 914 6.0E-09
sp|Q10367|GLO3_SCHPO ADP-ribosylation factor GTPase-activating protein glo3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo3 PE=3 SV=2 826 906 6.0E-09
sp|O80925|AGD7_ARATH ADP-ribosylation factor GTPase-activating protein AGD7 OS=Arabidopsis thaliana GN=AGD7 PE=1 SV=1 845 889 7.0E-09
sp|Q8N6H7|ARFG2_HUMAN ADP-ribosylation factor GTPase-activating protein 2 OS=Homo sapiens GN=ARFGAP2 PE=1 SV=1 842 889 7.0E-09
sp|A1L520|ARFG2_BOVIN ADP-ribosylation factor GTPase-activating protein 2 OS=Bos taurus GN=ARFGAP2 PE=2 SV=1 842 889 7.0E-09
sp|O75689|ADAP1_HUMAN Arf-GAP with dual PH domain-containing protein 1 OS=Homo sapiens GN=ADAP1 PE=1 SV=2 841 948 9.0E-09
sp|Q5RAT7|ARFG2_PONAB ADP-ribosylation factor GTPase-activating protein 2 OS=Pongo abelii GN=ARFGAP2 PE=2 SV=1 845 889 9.0E-09
sp|Q09531|YQP4_CAEEL Uncharacterized protein F07F6.4 OS=Caenorhabditis elegans GN=F07F6.4 PE=3 SV=2 842 915 2.0E-08
sp|Q28CM8|ARFG2_XENTR ADP-ribosylation factor GTPase-activating protein 2 OS=Xenopus tropicalis GN=arfgap2 PE=2 SV=1 845 889 2.0E-08
sp|Q9M354|AGD6_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD6 OS=Arabidopsis thaliana GN=AGD6 PE=1 SV=1 845 889 2.0E-08
sp|P35197|GCS1_YEAST ADP-ribosylation factor GTPase-activating protein GCS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCS1 PE=1 SV=1 826 889 2.0E-08
sp|Q9D8S3|ARFG3_MOUSE ADP-ribosylation factor GTPase-activating protein 3 OS=Mus musculus GN=Arfgap3 PE=1 SV=2 842 889 4.0E-08
sp|Q17R07|ARFG3_BOVIN ADP-ribosylation factor GTPase-activating protein 3 OS=Bos taurus GN=ARFGAP3 PE=2 SV=1 842 889 4.0E-08
sp|Q4KLN7|ARFG3_RAT ADP-ribosylation factor GTPase-activating protein 3 OS=Rattus norvegicus GN=Arfgap3 PE=1 SV=1 845 889 4.0E-08
sp|Q4R4C9|ARFG3_MACFA ADP-ribosylation factor GTPase-activating protein 3 OS=Macaca fascicularis GN=ARFGAP3 PE=2 SV=1 845 889 5.0E-08
sp|Q5R787|ARFG3_PONAB ADP-ribosylation factor GTPase-activating protein 3 OS=Pongo abelii GN=ARFGAP3 PE=2 SV=1 845 889 6.0E-08
sp|Q9NP61|ARFG3_HUMAN ADP-ribosylation factor GTPase-activating protein 3 OS=Homo sapiens GN=ARFGAP3 PE=1 SV=1 845 889 7.0E-08
sp|Q1ZXH8|GXCDD_DICDI Guanine exchange factor for Rac 30 OS=Dictyostelium discoideum GN=gxcDD PE=3 SV=3 845 941 2.0E-07
sp|O94601|YC8E_SCHPO Uncharacterized protein C622.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC622.14 PE=3 SV=2 830 889 2.0E-07
sp|Q9SMX5|AGD4_ARATH ADP-ribosylation factor GTPase-activating protein AGD4 OS=Arabidopsis thaliana GN=AGD4 PE=2 SV=2 303 570 5.0E-06
sp|Q9C6C3|AGD2_ARATH ADP-ribosylation factor GTPase-activating protein AGD2 OS=Arabidopsis thaliana GN=AGD2 PE=2 SV=1 303 552 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005096 GTPase activator activity Yes
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0003674 molecular_function No
GO:0008047 enzyme activator activity No
GO:0030234 enzyme regulator activity No
GO:0030695 GTPase regulator activity No
GO:0098772 molecular function regulator No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6577
MGNVSSRPDDGAALFLRDQSRLSISSLVVTNPRKRSSINILPNAFPASRLSAFRQGGDASPVEYVQDPEPPSPSS
QPAFLVKLHGDDELIFTFTFVMHQAQNPGSSAPTADATSAQADTSISGLTFVCASTTREVENLVTREFHADPNLH
KNANVDLVGDYSTNGASTVSFEWTWKWKPPKPLEDRGGGWRNSCSFVEYDSRAHRLLTLASFSYWVSSGSSALSH
PGSPSPPFLLASPPKIRVASAQSVDSRLTAAAADVDEPVSPLLPPHDGNALAVLPLAKEPVKVDVPCPRPGDDVT
VSDDGPVFRATLKALEQKTGNMRTQIKKVLKRAEQAHECQIEANDAFIAFMDALREASSTNANAVQPALEHYFDN
IAREVLSYERHNTANLQRIIIEPLSKVYQLDIKQAESKKRDFEEESKDYYAYVSRYLGQRQDSVKAKKLAESDSK
YQNKRRNFELKRFDYSSFMQDLHGGRKEQEVLSHLTRYAGAQTQGFLATAKKIEGFMPQLEALSTEVQEADKEYQ
YRRREREEKRRVLEKSNTPYLEPEQATLTSSMPGASHANGNAGNVSDSELGRADSTGSQAKNAISIGGGQTSVAH
GVELSRSPGSLSQPAVGSPAQSSKFKGIRDLEERDSTQAVAGQRKEGLLWALNRPGGHVDPRTLNKQGWHKFWIV
LDQGKLSEYSNWKQRLDLHMDPIDLRMASVREARNAERRFCFEVITPSFKRVYQATSEDDMNSWILSINNALQSA
MEGRAVQDKVGHSKGHGESSGKRDIGSILTGKTQSLGHGATHPHHHSSSSSGLPLRRITVGARPTMMRTSSGGYD
ETPDKLLQMVREADQGNCWCADCGSGSKVEWVSINLGIVLCIECSGIHRSLGTHISKVRSLTLDIKSFTIDIVEV
LLLIGNRVSNMVWEARLDPATKPGAHATREQRLRFITAKYVERAFVEPISATLSRYATADETLLAAIKKNEIQQV
LYALALRANPNVVDRMRGTHAIWLALAAADPASPSPTPGVGAAEAETKAVPFPVAELLIQNGAEIPAMLPAFPLG
RYAQQYYEQKASRGHGGPNGGAPPLPPRTSDAGDKLQREREARLQKRVSAGGRLAKSPIPEK*
Coding >Hirsu2|6577
ATGGGCAACGTGAGCAGCCGGCCCGACGACGGGGCCGCCCTGTTCCTCCGCGACCAGAGCCGCTTGTCCATCTCC
TCCCTCGTCGTCACGAACCCGCGCAAGCGCTCCTCCATCAACATCCTTCCCAATGCATTCCCAGCAAGCAGACTA
TCCGCCTTCCGCCAGGGCGGCGACGCCTCGCCCGTAGAATACGTTCAGGACCCTGAGCCGCCGAGCCCGAGCAGC
CAGCCGGCCTTTCTCGTCAAGCTCCACGGCGACGACGAGCTCATCTTCACCTTCACCTTCGTCATGCACCAGGCG
CAGAACCCGGGCTCCAGCGCGCCGACGGCCGACGCCACCTCCGCACAGGCAGACACCAGCATCTCGGGCCTCACC
TTCGTCTGTGCCTCCACCACGCGCGAAGTCGAGAACCTCGTCACCCGCGAGTTCCACGCCGACCCCAACCTTCAC
AAGAACGCCAACGTCGACCTCGTCGGCGACTACTCCACCAACGGCGCTTCCACCGTCTCCTTCGAATGGACCTGG
AAGTGGAAACCGCCGAAGCCGTTGGAAGACAGGGGCGGCGGCTGGCGAAACTCGTGCAGTTTTGTCGAGTACGAT
TCGCGAGCCCACCGCCTCCTCACCCTGGCCAGCTTTTCGTATTGGGTTTCAAGCGGAAGCTCAGCCCTGAGCCAC
CCTGGCTCGCCTTCGCCGCCATTCCTCCTCGCCTCGCCTCCCAAGATTCGCGTTGCCTCGGCCCAGTCGGTCGAC
TCCCGACTCACGGCCGCCGCCGCCGACGTCGACGAACCCGTTTCCCCACTCTTGCCCCCCCACGACGGCAACGCT
CTGGCCGTGCTGCCCCTGGCCAAGGAGCCCGTCAAGGTGGATGTCCCCTGTCCCCGACCCGGCGACGACGTGACG
GTCAGCGACGACGGGCCCGTCTTCCGCGCCACTCTCAAGGCGCTGGAGCAGAAGACGGGAAACATGCGGACGCAG
ATCAAGAAGGTCCTGAAGCGTGCCGAACAGGCGCACGAGTGTCAGATCGAGGCCAACGACGCATTCATCGCCTTC
ATGGATGCCTTGCGCGAGGCTTCCTCGACCAACGCCAACGCCGTGCAGCCGGCCCTGGAGCACTACTTCGACAAC
ATCGCCCGTGAGGTCCTCAGCTACGAGCGGCACAACACGGCCAACCTCCAGCGGATCATCATCGAGCCGCTGAGC
AAGGTCTACCAGCTCGACATCAAGCAGGCGGAATCCAAGAAGCGAGACTTTGAGGAAGAGAGCAAGGATTACTAC
GCCTACGTATCCCGCTACCTCGGTCAGCGCCAGGACTCGGTCAAGGCTAAGAAACTGGCCGAGAGCGATTCCAAG
TACCAGAACAAGCGGCGCAACTTTGAGCTGAAGCGCTTCGACTACTCCAGCTTCATGCAGGACCTCCACGGCGGG
CGCAAGGAGCAGGAGGTCTTGTCTCACCTGACAAGGTACGCCGGGGCACAGACCCAGGGCTTCCTCGCCACGGCC
AAGAAGATCGAGGGCTTCATGCCACAGCTGGAGGCGCTGTCGACCGAGGTCCAGGAGGCCGACAAGGAGTATCAG
TACCGCCGCCGCGAGCGCGAGGAGAAGCGCCGCGTCCTGGAGAAGAGCAACACGCCGTACCTGGAGCCCGAGCAG
GCGACCCTGACCAGCTCCATGCCGGGTGCCTCGCACGCCAACGGGAACGCCGGCAACGTCTCCGATTCGGAGCTC
GGCCGCGCAGACAGCACCGGATCCCAGGCAAAGAACGCCATCTCGATCGGCGGCGGCCAAACCAGCGTCGCCCAC
GGCGTCGAGCTGTCGAGATCCCCCGGCAGCCTGTCGCAGCCGGCCGTCGGCAGCCCCGCCCAGTCGTCCAAGTTC
AAGGGGATCCGCGACTTGGAGGAGCGAGACTCGACGCAGGCGGTCGCCGGCCAGCGCAAGGAGGGCCTCCTCTGG
GCACTGAACCGGCCTGGCGGGCATGTGGACCCGCGGACGCTGAACAAGCAGGGCTGGCACAAGTTCTGGATCGTG
CTAGACCAGGGCAAGCTGTCCGAGTACAGCAACTGGAAGCAGAGGCTGGATCTACACATGGACCCCATCGACCTC
CGGATGGCGTCGGTCCGCGAGGCGCGAAACGCGGAGCGCCGGTTCTGCTTCGAGGTCATCACGCCCAGCTTCAAG
CGGGTGTACCAGGCGACGTCGGAGGACGACATGAACAGCTGGATCCTCTCCATCAACAACGCCTTGCAGAGCGCC
ATGGAGGGGCGAGCTGTGCAGGACAAGGTCGGGCACTCCAAGGGCCACGGGGAATCGTCGGGCAAGCGAGACATC
GGGTCGATTCTGACGGGCAAGACGCAGTCGCTCGGCCACGGCGCCACGCACCCGCATCATCATTCCAGCTCCAGC
AGCGGGCTGCCCCTCCGGCGGATCACGGTCGGGGCGAGGCCGACGATGATGCGGACGTCGAGCGGAGGCTACGAC
GAGACGCCGGACAAGCTGCTGCAGATGGTGCGGGAGGCGGACCAGGGCAACTGCTGGTGCGCCGACTGCGGCTCC
GGGTCCAAGGTGGAGTGGGTGTCGATCAACCTGGGCATCGTGCTGTGCATCGAGTGCAGCGGCATCCACCGCTCG
CTGGGCACGCACATCAGCAAGGTGCGGTCGCTCACGCTGGACATCAAGTCGTTCACGATCGATATAGTCGAGGTG
CTGCTGCTCATCGGAAACCGCGTCTCCAACATGGTGTGGGAGGCGCGGCTGGACCCGGCCACCAAGCCGGGGGCG
CACGCGACGCGGGAACAGCGGCTGCGGTTCATCACGGCCAAGTACGTGGAGCGGGCGTTCGTGGAGCCCATCTCG
GCGACGCTGTCGAGGTACGCGACGGCGGACGAGACGCTGCTGGCGGCCATCAAGAAGAACGAGATCCAGCAGGTG
CTGTACGCGCTGGCGCTGAGGGCCAACCCCAACGTGGTGGACAGGATGAGGGGGACGCACGCCATCTGGCTCGCG
CTGGCGGCGGCGGACCCGGCGTCGCCGTCGCCGACGCCGGGCGTGGGCGCGGCGGAGGCGGAGACCAAGGCAGTG
CCCTTCCCGGTGGCGGAGCTCCTGATCCAGAATGGGGCCGAGATCCCGGCGATGCTGCCGGCCTTCCCGCTCGGG
CGGTACGCGCAGCAGTACTACGAGCAGAAGGCGAGCCGAGGCCACGGCGGGCCCAACGGCGGGGCGCCGCCGCTG
CCGCCGCGCACGTCGGATGCCGGCGACAAGCTGCAGCGGGAGAGGGAGGCGCGGTTGCAGAAGCGCGTGAGCGCG
GGCGGACGCCTGGCAAAGTCGCCGATCCCCGAAAAATAG
Transcript >Hirsu2|6577
ATGGGCAACGTGAGCAGCCGGCCCGACGACGGGGCCGCCCTGTTCCTCCGCGACCAGAGCCGCTTGTCCATCTCC
TCCCTCGTCGTCACGAACCCGCGCAAGCGCTCCTCCATCAACATCCTTCCCAATGCATTCCCAGCAAGCAGACTA
TCCGCCTTCCGCCAGGGCGGCGACGCCTCGCCCGTAGAATACGTTCAGGACCCTGAGCCGCCGAGCCCGAGCAGC
CAGCCGGCCTTTCTCGTCAAGCTCCACGGCGACGACGAGCTCATCTTCACCTTCACCTTCGTCATGCACCAGGCG
CAGAACCCGGGCTCCAGCGCGCCGACGGCCGACGCCACCTCCGCACAGGCAGACACCAGCATCTCGGGCCTCACC
TTCGTCTGTGCCTCCACCACGCGCGAAGTCGAGAACCTCGTCACCCGCGAGTTCCACGCCGACCCCAACCTTCAC
AAGAACGCCAACGTCGACCTCGTCGGCGACTACTCCACCAACGGCGCTTCCACCGTCTCCTTCGAATGGACCTGG
AAGTGGAAACCGCCGAAGCCGTTGGAAGACAGGGGCGGCGGCTGGCGAAACTCGTGCAGTTTTGTCGAGTACGAT
TCGCGAGCCCACCGCCTCCTCACCCTGGCCAGCTTTTCGTATTGGGTTTCAAGCGGAAGCTCAGCCCTGAGCCAC
CCTGGCTCGCCTTCGCCGCCATTCCTCCTCGCCTCGCCTCCCAAGATTCGCGTTGCCTCGGCCCAGTCGGTCGAC
TCCCGACTCACGGCCGCCGCCGCCGACGTCGACGAACCCGTTTCCCCACTCTTGCCCCCCCACGACGGCAACGCT
CTGGCCGTGCTGCCCCTGGCCAAGGAGCCCGTCAAGGTGGATGTCCCCTGTCCCCGACCCGGCGACGACGTGACG
GTCAGCGACGACGGGCCCGTCTTCCGCGCCACTCTCAAGGCGCTGGAGCAGAAGACGGGAAACATGCGGACGCAG
ATCAAGAAGGTCCTGAAGCGTGCCGAACAGGCGCACGAGTGTCAGATCGAGGCCAACGACGCATTCATCGCCTTC
ATGGATGCCTTGCGCGAGGCTTCCTCGACCAACGCCAACGCCGTGCAGCCGGCCCTGGAGCACTACTTCGACAAC
ATCGCCCGTGAGGTCCTCAGCTACGAGCGGCACAACACGGCCAACCTCCAGCGGATCATCATCGAGCCGCTGAGC
AAGGTCTACCAGCTCGACATCAAGCAGGCGGAATCCAAGAAGCGAGACTTTGAGGAAGAGAGCAAGGATTACTAC
GCCTACGTATCCCGCTACCTCGGTCAGCGCCAGGACTCGGTCAAGGCTAAGAAACTGGCCGAGAGCGATTCCAAG
TACCAGAACAAGCGGCGCAACTTTGAGCTGAAGCGCTTCGACTACTCCAGCTTCATGCAGGACCTCCACGGCGGG
CGCAAGGAGCAGGAGGTCTTGTCTCACCTGACAAGGTACGCCGGGGCACAGACCCAGGGCTTCCTCGCCACGGCC
AAGAAGATCGAGGGCTTCATGCCACAGCTGGAGGCGCTGTCGACCGAGGTCCAGGAGGCCGACAAGGAGTATCAG
TACCGCCGCCGCGAGCGCGAGGAGAAGCGCCGCGTCCTGGAGAAGAGCAACACGCCGTACCTGGAGCCCGAGCAG
GCGACCCTGACCAGCTCCATGCCGGGTGCCTCGCACGCCAACGGGAACGCCGGCAACGTCTCCGATTCGGAGCTC
GGCCGCGCAGACAGCACCGGATCCCAGGCAAAGAACGCCATCTCGATCGGCGGCGGCCAAACCAGCGTCGCCCAC
GGCGTCGAGCTGTCGAGATCCCCCGGCAGCCTGTCGCAGCCGGCCGTCGGCAGCCCCGCCCAGTCGTCCAAGTTC
AAGGGGATCCGCGACTTGGAGGAGCGAGACTCGACGCAGGCGGTCGCCGGCCAGCGCAAGGAGGGCCTCCTCTGG
GCACTGAACCGGCCTGGCGGGCATGTGGACCCGCGGACGCTGAACAAGCAGGGCTGGCACAAGTTCTGGATCGTG
CTAGACCAGGGCAAGCTGTCCGAGTACAGCAACTGGAAGCAGAGGCTGGATCTACACATGGACCCCATCGACCTC
CGGATGGCGTCGGTCCGCGAGGCGCGAAACGCGGAGCGCCGGTTCTGCTTCGAGGTCATCACGCCCAGCTTCAAG
CGGGTGTACCAGGCGACGTCGGAGGACGACATGAACAGCTGGATCCTCTCCATCAACAACGCCTTGCAGAGCGCC
ATGGAGGGGCGAGCTGTGCAGGACAAGGTCGGGCACTCCAAGGGCCACGGGGAATCGTCGGGCAAGCGAGACATC
GGGTCGATTCTGACGGGCAAGACGCAGTCGCTCGGCCACGGCGCCACGCACCCGCATCATCATTCCAGCTCCAGC
AGCGGGCTGCCCCTCCGGCGGATCACGGTCGGGGCGAGGCCGACGATGATGCGGACGTCGAGCGGAGGCTACGAC
GAGACGCCGGACAAGCTGCTGCAGATGGTGCGGGAGGCGGACCAGGGCAACTGCTGGTGCGCCGACTGCGGCTCC
GGGTCCAAGGTGGAGTGGGTGTCGATCAACCTGGGCATCGTGCTGTGCATCGAGTGCAGCGGCATCCACCGCTCG
CTGGGCACGCACATCAGCAAGGTGCGGTCGCTCACGCTGGACATCAAGTCGTTCACGATCGATATAGTCGAGGTG
CTGCTGCTCATCGGAAACCGCGTCTCCAACATGGTGTGGGAGGCGCGGCTGGACCCGGCCACCAAGCCGGGGGCG
CACGCGACGCGGGAACAGCGGCTGCGGTTCATCACGGCCAAGTACGTGGAGCGGGCGTTCGTGGAGCCCATCTCG
GCGACGCTGTCGAGGTACGCGACGGCGGACGAGACGCTGCTGGCGGCCATCAAGAAGAACGAGATCCAGCAGGTG
CTGTACGCGCTGGCGCTGAGGGCCAACCCCAACGTGGTGGACAGGATGAGGGGGACGCACGCCATCTGGCTCGCG
CTGGCGGCGGCGGACCCGGCGTCGCCGTCGCCGACGCCGGGCGTGGGCGCGGCGGAGGCGGAGACCAAGGCAGTG
CCCTTCCCGGTGGCGGAGCTCCTGATCCAGAATGGGGCCGAGATCCCGGCGATGCTGCCGGCCTTCCCGCTCGGG
CGGTACGCGCAGCAGTACTACGAGCAGAAGGCGAGCCGAGGCCACGGCGGGCCCAACGGCGGGGCGCCGCCGCTG
CCGCCGCGCACGTCGGATGCCGGCGACAAGCTGCAGCGGGAGAGGGAGGCGCGGTTGCAGAAGCGCGTGAGCGCG
GGCGGACGCCTGGCAAAGTCGCCGATCCCCGAAAAATAG
Gene >Hirsu2|6577
ATGGGCAACGTGAGCAGCCGGCCCGACGACGGGGCCGCCCTGTTCCTCCGCGACCAGAGCCGCTGTACGCCCCTC
GCCCGTCCTCGCGCTGCCCCCTTGCCTTGCTGCTCGTGGCCCGGCTGACGATGCTTCTCGGCCGCGACCAGTGTC
CATCTCCTCCCTCGTCGTCACGAACCCGCGCAAGCGCTCCTCCATCAACATCCTTCCCAATGCATTCCCAGCAAG
CAGACTATCCGCCTTCCGCCAGGGCGGCGACGCCTCGCCCGTAGAATACGTTCAGGTCCGTCTCGCGCCGCTCCC
GTCCCGGCTCCCCCGCTGACCCGGATCCGACCACCAGGACCCTGAGCCGCCGAGCCCGAGCAGCCAGCCGGCCTT
TCTCGTCAAGCTCCACGGCGACGACGAGCTCATCTTCACCTTCACCTTCGTCATGCACCAGGCGCAGAACCCGGG
CTCCAGCGCGCCGACGGCCGACGCCACCTCCGCACAGGCAGACACCAGCATCTCGGGCCTCACCTTCGTCTGTGC
CTCCACCACGCGCGAAGTCGAGAACCTCGTCACCCGCGAGTTCCACGCCGACCCCAACCTTCACAAGAACGCCAA
CGTCGACCTCGTCGGCGACTACTCCACCAACGGCGCTTCCACCGTCTCCTTCGAATGGACCTGGAAGTGGAAACC
GCCGAAGCCGTTGGAAGACAGGGGCGGCGGCTGGCGAAACTCGTGCAGTGTAAGATGGGCCTTGCCGCCTGCGAA
GCCCGGGCCGCTGACCGGGTGCCCAGTTTGTCGAGTACGATTCGCGAGCCCACCGCCTCCTCACCCTGGCCAGCT
TTTCGTATTGGGTTTCAAGTAGGTCTGCCCCGCGCGCACGTCGACAAGTGCCGGCCGGGCCGTGCTGACGCGCTT
TCCTCCAGGCGGAAGCTCAGCCCTGAGCCACCCTGGCTCGCCTTCGCCGCCATTCCTCCTCGCCTCGCCTCCCAA
GATTCGCGTTGCCTCGGCCCAGTCGGTCGACTCCCGACTCACGGCCGCCGCCGCCGACGTCGACGAACCCGTTTC
CCCACTCTTGCCCCCCCACGACGGCAACGCTCTGGCCGTGCTGCCCCTGGCCAAGGAGCCCGTCAAGGTGGATGT
CCCCTGTCCCCGACCCGGCGACGACGTGACGGTCAGCGACGACGGGCCCGTCTTCCGCGCCACTCTCAAGGCGCT
GGAGCAGAAGACGGGAAACATGCGGACGCAGATCAAGAAGGTCCTGAAGCGTGCCGAACAGGCGCACGAGTGTCA
GATCGAGGCCAACGACGCATTCATCGCCTTCATGGATGCCTTGCGCGAGGCTTCCTCGACCAACGCCAACGCCGT
GCAGCCGGCCCTGGAGCACTACTTCGACAACATCGCCCGTGAGGTCCTCAGCTACGAGCGGCACAACACGGCCAA
CCTCCAGCGGATCATCATCGAGCCGCTGAGCAAGGTCTACCAGCTCGACATCAAGCAGGCGGAATCCAAGAAGCG
AGACTTTGAGGAAGAGAGCAAGGATTACTACGCCTACGTATCCCGCTACCTCGGTCAGCGCCAGGACTCGGTCAA
GGCTAAGAAACTGGCCGAGAGCGATTCCAAGTACCAGAACAAGCGGCGCAACTTTGAGCTGAAGCGCTTCGACTA
CTCCAGCTTCATGCAGGACCTCCACGGCGGGCGCAAGGAGCAGGAGGTCTTGTCTCACCTGACAAGGTACGCCGG
GGCACAGACCCAGGGCTTCCTCGCCACGGCCAAGAAGATCGAGGGCTTCATGCCACAGCTGGAGGCGCTGTCGAC
CGAGGTCCAGGAGGCCGACAAGGAGTATCAGTACCGCCGCCGCGAGCGCGAGGAGAAGCGCCGCGTCCTGGAGAA
GAGCAACACGCCGTACCTGGAGCCCGAGCAGGCGACCCTGACCAGCTCCATGCCGGGTGCCTCGCACGCCAACGG
GAACGCCGGCAACGTCTCCGATTCGGAGCTCGGCCGCGCAGACAGCACCGGATCCCAGGCAAAGAACGCCATCTC
GATCGGCGGCGGCCAAACCAGCGTCGCCCACGGCGTCGAGCTGTCGAGATCCCCCGGCAGCCTGTCGCAGCCGGC
CGTCGGCAGCCCCGCCCAGTCGTCCAAGTTCAAGGGGATCCGCGACTTGGAGGAGCGAGACTCGACGCAGGCGGT
CGCCGGCCAGCGCAAGGAGGGCCTCCTCTGGGCACTGAACCGGCCTGGCGGGCATGTGGACCCGCGGACGCTGAA
CAAGCAGGGCTGGCACAAGTACGTTGAGCGTGGCGGGGTGTGTGGCGAGAGGCGCCGGCGCGGCTGACTTGGAAA
CAAATAAACAGGTTCTGGATCGTGCTAGACCAGGGCAAGCTGTCCGAGTACAGCAACTGGAAGCAGAGGCTGGAT
CTACACATGGACCCCATCGACCTCCGGATGGCGTCGGTCCGCGAGGCGCGAAACGCGGAGCGCCGGTTCTGCTTC
GAGGTCATCACGCCCAGCTTCAAGCGGGTGTACCAGGCGACGTCGGAGGACGACATGAACAGCTGGATCCTCTCC
ATCAACAACGCCTTGCAGAGCGCCATGGAGGGGCGAGCTGTGCAGGACAAGGTCGGGCACTCCAAGGGCCACGGG
GAATCGTCGGGCAAGCGAGACATCGGGTCGATTCTGACGGGCAAGACGCAGTCGCTCGGCCACGGCGCCACGCAC
CCGCATCATCATTCCAGCTCCAGCAGCGGGCTGCCCCTCCGGCGGATCACGGTCGGGGCGAGGCCGACGATGATG
CGGACGTCGAGCGGAGGCTACGACGAGACGCCGGACAAGCTGCTGCAGATGGTGCGGGAGGCGGACCAGGGCAAC
TGCTGGTGCGCCGACTGCGGCTCCGGGTCCAAGGTGGAGTGGGTGTCGATCAACCTGGGCATCGTGCTGTGCATC
GAGTGCAGCGGCATCCACCGCTCGCTGGGCACGCACATCAGCAAGGTGCGGTCGCTCACGCTGGACATCAAGTCG
TTCACGATCGATATAGTCGAGGTGCTGCTGCTCATCGGAAACCGCGTCTCCAACATGGTGTGGGAGGCGCGGCTG
GACCCGGCCACCAAGCCGGGGGCGCACGCGACGCGGGAACAGCGGCTGCGGTTCATCACGGCCAAGTACGTGGAG
CGGGCGTTCGTGGAGCCCATCTCGGCGACGCTGTCGAGGTACGCGACGGCGGACGAGACGCTGCTGGCGGCCATC
AAGAAGAACGAGATCCAGCAGGTGCTGTACGCGCTGGCGCTGAGGGCCAACCCCAACGTGGTGGACAGGATGAGG
GGGACGCACGCCATCTGGCTCGCGCTGGCGGCGGCGGACCCGGCGTCGCCGTCGCCGACGCCGGGCGTGGGCGCG
GCGGAGGCGGAGACCAAGGCAGTGCCCTTCCCGGTGGCGGAGCTCCTGATCCAGAATGGGGCCGAGATCCCGGCG
ATGCTGCCGGCCTTCCCGCTCGGGCGGTACGCGCAGCAGTACTACGAGCAGAAGGCGAGCCGAGGCCACGGCGGG
CCCAACGGCGGGGCGCCGCCGCTGCCGCCGCGCACGTCGGATGCCGGCGACAAGCTGCAGCGGGAGAGGGAGGCG
CGGTTGCAGAAGCGCGTGAGCGCGGGCGGACGCCTGGCAAAGTCGCCGATCCCCGAAAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail