Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6570
Gene name
LocationContig_34:44385..46498
Strand-
Gene length (bp)2113
Transcript length (bp)1890
Coding sequence length (bp)1890
Protein length (aa) 630

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03098 An_peroxidase Animal haem peroxidase 4.3E-112 79 599

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C9U3|DOX2_ARATH Alpha-dioxygenase 2 OS=Arabidopsis thaliana GN=DOX2 PE=2 SV=1 7 616 9.0E-111
sp|Q9SGH6|DOX1_ARATH Alpha-dioxygenase 1 OS=Arabidopsis thaliana GN=DOX1 PE=1 SV=1 9 616 3.0E-105
sp|Q23490|MLT7_CAEEL Peroxidase mlt-7 OS=Caenorhabditis elegans GN=mlt-7 PE=1 SV=1 76 617 2.0E-23
sp|Q01603|PERO_DROME Peroxidase OS=Drosophila melanogaster GN=Pxd PE=2 SV=2 79 591 1.0E-17
sp|P11678|PERE_HUMAN Eosinophil peroxidase OS=Homo sapiens GN=EPX PE=1 SV=2 79 540 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C9U3|DOX2_ARATH Alpha-dioxygenase 2 OS=Arabidopsis thaliana GN=DOX2 PE=2 SV=1 7 616 9.0E-111
sp|Q9SGH6|DOX1_ARATH Alpha-dioxygenase 1 OS=Arabidopsis thaliana GN=DOX1 PE=1 SV=1 9 616 3.0E-105
sp|Q23490|MLT7_CAEEL Peroxidase mlt-7 OS=Caenorhabditis elegans GN=mlt-7 PE=1 SV=1 76 617 2.0E-23
sp|Q01603|PERO_DROME Peroxidase OS=Drosophila melanogaster GN=Pxd PE=2 SV=2 79 591 1.0E-17
sp|P11678|PERE_HUMAN Eosinophil peroxidase OS=Homo sapiens GN=EPX PE=1 SV=2 79 540 3.0E-13
sp|P49290|PERE_MOUSE Eosinophil peroxidase OS=Mus musculus GN=Epx PE=1 SV=2 79 573 6.0E-13
sp|Q1ENI8|PXDN_CAEEL Peroxidasin homolog OS=Caenorhabditis elegans GN=pxn-1 PE=1 SV=1 69 587 2.0E-12
sp|Q9VEG6|PERC_DROME Chorion peroxidase OS=Drosophila melanogaster GN=Pxt PE=2 SV=3 79 607 2.0E-11
sp|Q9MZF4|DUOX1_CANLF Dual oxidase 1 OS=Canis lupus familiaris GN=DUOX1 PE=1 SV=1 82 331 2.0E-07
sp|Q9NRD8|DUOX2_HUMAN Dual oxidase 2 OS=Homo sapiens GN=DUOX2 PE=1 SV=2 82 323 3.0E-07
sp|Q9NRD9|DUOX1_HUMAN Dual oxidase 1 OS=Homo sapiens GN=DUOX1 PE=1 SV=1 82 323 5.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6570
MDLPKYKPSLLERISVKVFSVVNKIVAWHKLPGFLGTVNLMAIRTTLRSNNLHDGYASVAAQGNSEDEPLTDERF
LHARHSDGKFNSLERPLMGCAGMRFGRQFPRKYCRKPTEEELWTPSPRLISDKFMARGPRGFIPATTLNLLAAAW
IQFQTHDWFSHEESCETFNVPLPDGDDWPQGKMTLLKTKPDDVLDPSDGECPGYRNKNTAWWDGSQIYGSNERVT
QILRARHQDGKLVLDRDGGPDALSHDVGGVPRTGFNDNWWLGLELLHSLFVLEHNAICDMLREAHPSWSGDKIFD
TARLVNCALLAKIHTIEWTPAVLAHPALQISMRGNWWGLVGEKLTKMVGRVSKSEAVSGIPGSGVDFFGVPYSLT
EEFVSVYRMHSLIPGKSDPARYNVAFFDAGDGAHRSTVPIEEMTFGGARRPFEDGLGLGDALYSFGINFAGAITN
NNYPAFLRRLHTPDGQVRDLGSVDIVRDRERGVPRYNQFRRLLGMRAPATFEELTGGDAGLAHELREAYAGDIEA
VDALVGSHSEPLPAGFGFSETAFRVFIVMASSRLKSDRFFADQWNAETYSPEGLRWAQDTSMKDILLRHCPELAA
SLERADNVFAPWEKLPKSNKYDGVETNAP*
Coding >Hirsu2|6570
ATGGACCTCCCCAAGTACAAGCCCAGCTTGCTGGAGCGCATCTCCGTCAAGGTCTTCAGCGTCGTCAACAAGATC
GTGGCATGGCACAAGCTCCCGGGCTTCCTCGGCACCGTCAATCTCATGGCCATTCGCACCACACTCCGCTCCAAC
AACCTCCACGACGGCTACGCCTCCGTGGCCGCCCAGGGCAACAGCGAGGACGAGCCTCTGACGGACGAGCGCTTC
CTCCACGCGCGCCACTCGGACGGCAAGTTCAACTCGCTTGAGAGGCCGTTGATGGGATGCGCCGGCATGCGGTTC
GGGCGCCAGTTCCCGCGCAAGTACTGCCGGAAGCCGACGGAGGAGGAGCTCTGGACGCCGAGCCCGCGGCTCATC
AGCGACAAGTTCATGGCCAGGGGGCCCCGGGGCTTCATCCCGGCCACGACGCTGAACCTGCTGGCCGCGGCCTGG
ATCCAGTTCCAGACCCATGACTGGTTCAGCCACGAAGAGAGCTGCGAAACTTTCAATGTGCCTCTCCCGGACGGC
GACGACTGGCCGCAGGGCAAGATGACGCTGTTGAAGACCAAGCCCGACGACGTGCTCGATCCGTCCGACGGCGAG
TGCCCGGGCTACCGAAACAAGAACACGGCCTGGTGGGACGGATCGCAGATCTACGGCTCCAACGAGAGGGTGACG
CAGATTCTGCGAGCCCGGCACCAGGACGGCAAGCTGGTGCTGGACCGGGACGGCGGCCCCGACGCCCTGTCGCAC
GACGTCGGCGGCGTGCCGAGGACGGGCTTCAACGACAACTGGTGGCTGGGGCTGGAGCTTCTGCACTCGCTGTTC
GTGCTGGAGCACAATGCCATCTGCGACATGCTGCGGGAAGCTCACCCGAGCTGGTCCGGAGACAAGATCTTCGAC
ACGGCCCGCCTCGTCAACTGCGCCCTCCTGGCCAAGATCCACACGATCGAGTGGACGCCGGCCGTGCTCGCGCAC
CCGGCCCTGCAGATCAGCATGAGAGGCAACTGGTGGGGGCTCGTGGGCGAGAAGCTGACCAAGATGGTCGGGCGC
GTCTCCAAGAGCGAGGCCGTCAGCGGCATCCCGGGATCGGGCGTCGACTTCTTCGGCGTCCCCTACTCGCTGACC
GAGGAGTTCGTGTCCGTGTACCGGATGCACTCGCTCATCCCAGGCAAGTCGGATCCAGCCCGATACAACGTCGCC
TTCTTCGACGCCGGCGACGGCGCGCACCGGTCAACGGTGCCGATCGAGGAGATGACGTTCGGCGGGGCGCGCCGG
CCGTTCGAGGACGGGCTCGGGCTCGGCGACGCGCTCTACTCGTTCGGCATCAACTTCGCCGGCGCCATCACCAAC
AACAACTACCCGGCCTTCCTGCGGCGGCTGCACACGCCCGACGGGCAGGTGCGCGACCTGGGCAGCGTCGACATC
GTGCGCGACCGCGAGCGCGGCGTGCCGCGCTACAACCAGTTCCGGCGCCTGCTCGGGATGCGCGCGCCGGCCACG
TTCGAGGAGCTGACGGGCGGCGACGCCGGCCTGGCGCACGAGCTGCGCGAGGCCTACGCCGGCGACATCGAGGCC
GTCGACGCCCTCGTCGGCTCCCACAGCGAGCCGCTGCCGGCCGGCTTCGGCTTCAGCGAGACGGCCTTCCGCGTC
TTCATCGTCATGGCCAGCAGCCGGCTCAAGAGCGACCGCTTCTTCGCCGACCAGTGGAACGCCGAGACGTACAGC
CCCGAGGGCCTGCGCTGGGCCCAGGACACGTCCATGAAGGACATCCTCCTCCGCCACTGCCCGGAGCTGGCCGCC
TCGCTCGAGCGGGCCGACAACGTCTTCGCCCCCTGGGAGAAGCTGCCCAAGTCGAACAAGTACGACGGCGTCGAG
ACGAATGCCCCGTAG
Transcript >Hirsu2|6570
ATGGACCTCCCCAAGTACAAGCCCAGCTTGCTGGAGCGCATCTCCGTCAAGGTCTTCAGCGTCGTCAACAAGATC
GTGGCATGGCACAAGCTCCCGGGCTTCCTCGGCACCGTCAATCTCATGGCCATTCGCACCACACTCCGCTCCAAC
AACCTCCACGACGGCTACGCCTCCGTGGCCGCCCAGGGCAACAGCGAGGACGAGCCTCTGACGGACGAGCGCTTC
CTCCACGCGCGCCACTCGGACGGCAAGTTCAACTCGCTTGAGAGGCCGTTGATGGGATGCGCCGGCATGCGGTTC
GGGCGCCAGTTCCCGCGCAAGTACTGCCGGAAGCCGACGGAGGAGGAGCTCTGGACGCCGAGCCCGCGGCTCATC
AGCGACAAGTTCATGGCCAGGGGGCCCCGGGGCTTCATCCCGGCCACGACGCTGAACCTGCTGGCCGCGGCCTGG
ATCCAGTTCCAGACCCATGACTGGTTCAGCCACGAAGAGAGCTGCGAAACTTTCAATGTGCCTCTCCCGGACGGC
GACGACTGGCCGCAGGGCAAGATGACGCTGTTGAAGACCAAGCCCGACGACGTGCTCGATCCGTCCGACGGCGAG
TGCCCGGGCTACCGAAACAAGAACACGGCCTGGTGGGACGGATCGCAGATCTACGGCTCCAACGAGAGGGTGACG
CAGATTCTGCGAGCCCGGCACCAGGACGGCAAGCTGGTGCTGGACCGGGACGGCGGCCCCGACGCCCTGTCGCAC
GACGTCGGCGGCGTGCCGAGGACGGGCTTCAACGACAACTGGTGGCTGGGGCTGGAGCTTCTGCACTCGCTGTTC
GTGCTGGAGCACAATGCCATCTGCGACATGCTGCGGGAAGCTCACCCGAGCTGGTCCGGAGACAAGATCTTCGAC
ACGGCCCGCCTCGTCAACTGCGCCCTCCTGGCCAAGATCCACACGATCGAGTGGACGCCGGCCGTGCTCGCGCAC
CCGGCCCTGCAGATCAGCATGAGAGGCAACTGGTGGGGGCTCGTGGGCGAGAAGCTGACCAAGATGGTCGGGCGC
GTCTCCAAGAGCGAGGCCGTCAGCGGCATCCCGGGATCGGGCGTCGACTTCTTCGGCGTCCCCTACTCGCTGACC
GAGGAGTTCGTGTCCGTGTACCGGATGCACTCGCTCATCCCAGGCAAGTCGGATCCAGCCCGATACAACGTCGCC
TTCTTCGACGCCGGCGACGGCGCGCACCGGTCAACGGTGCCGATCGAGGAGATGACGTTCGGCGGGGCGCGCCGG
CCGTTCGAGGACGGGCTCGGGCTCGGCGACGCGCTCTACTCGTTCGGCATCAACTTCGCCGGCGCCATCACCAAC
AACAACTACCCGGCCTTCCTGCGGCGGCTGCACACGCCCGACGGGCAGGTGCGCGACCTGGGCAGCGTCGACATC
GTGCGCGACCGCGAGCGCGGCGTGCCGCGCTACAACCAGTTCCGGCGCCTGCTCGGGATGCGCGCGCCGGCCACG
TTCGAGGAGCTGACGGGCGGCGACGCCGGCCTGGCGCACGAGCTGCGCGAGGCCTACGCCGGCGACATCGAGGCC
GTCGACGCCCTCGTCGGCTCCCACAGCGAGCCGCTGCCGGCCGGCTTCGGCTTCAGCGAGACGGCCTTCCGCGTC
TTCATCGTCATGGCCAGCAGCCGGCTCAAGAGCGACCGCTTCTTCGCCGACCAGTGGAACGCCGAGACGTACAGC
CCCGAGGGCCTGCGCTGGGCCCAGGACACGTCCATGAAGGACATCCTCCTCCGCCACTGCCCGGAGCTGGCCGCC
TCGCTCGAGCGGGCCGACAACGTCTTCGCCCCCTGGGAGAAGCTGCCCAAGTCGAACAAGTACGACGGCGTCGAG
ACGAATGCCCCGTAG
Gene >Hirsu2|6570
ATGGACCTCCCCAAGTACAAGCCCAGCTTGCTGGAGCGCATCTCCGTCAAGGTCTTCAGCGTCGTCAACAAGATC
GTGGCATGGCACAAGCTCCCGGGCTTCCTCGGCACCGTCAATCTCATGGCCATTCGCACCACACTCCGCTCCAAC
AACCTCCACGACGGCTACGCCTCCGTGGCCGCCCAGGGCAACAGCGAGGACGAGCCTCTGACGGACGAGCGCTTC
CTCCACGCGCGCCACTCGGACGGCAAGTTCAACTCGCTTGAGAGGCCGTTGATGGGATGCGCCGGCATGCGGTTC
GGGCGCCAGTTCCCGCGCAAGTACTGCCGGAAGCCGACGGAGGAGGAGCTCTGGACGCCGAGCCCGCGGCTCATC
AGCGACAAGTTCATGGCCAGGGGGCCCCGGGGCTTCATCCCGGCCACGACGCTGAACCTGCTGGCCGCGGCCTGG
ATCCAGTTCCAGACCCATGACTGGTTCAGCCACGAAGAGGTCAGTCTTGGCTCGCCCCTCGGTCCGGAAACTTGC
TCGACATGAATGGTGAGCGACTGCGTTCTGACTGACACTTGTTTCAAAGAGCTGCGAAACTTTCAATGTGCCTCT
CCCGGACGGCGACGACTGGCCGCAGGGCAAGATGACGCTGTTGAAGACCAAGCCCGACGACGTGCTCGATCCGTC
CGACGGCGAGTGCCCGGGCTACCGAAACAAGAACACGGCCTGGTGGGACGGATCGCAGATCTACGGCTCCAACGA
GAGGGTGACGCAGATTCTGCGAGCCCGGCACCAGGACGGCAAGCTGGTGCTGGACCGGGACGGCGGCCCCGACGC
CCTGTCGCACGACGTCGGCGGCGTGCCGAGGACGGGCTTCAACGACAACTGGTGGCTGGGGCTGGAGCTTCTGCA
CTCGCTGTTCGTGCTGGAGCACAATGCCATCTGCGACATGCTGCGGGAAGCTCACCCGAGCTGGTCCGGGTAGGG
GCTTGCCTCCAGCCGTGCATGCGACCCGATGCTGACGGACGATGCCGTTCTCCAGAGACAAGATCTTCGACACGG
CCCGCCTCGTCAACTGCGCCCTCCTGGCCAAGATCCACACGATCGAGTGGACGCCGGCCGTGCTCGCGCACCCGG
CCCTGCAGATCAGCATGAGAGGCAACTGGTGGGGGCTCGTGGGCGAGAAGCTGACCAAGATGGTCGGGCGCGTCT
CCAAGAGCGAGGCCGTCAGCGGCATCCCGGGATCGGGCGTCGACTTCTTCGGCGTCCCCTACTCGCTGACCGAGG
AGTTCGTGTCCGTGTACCGGATGCACTCGCTCATCCCAGGCAAGTCGGATCCAGCCCGATGTCTTCCTCGGCGGA
GAGGGAGGCGGCGAGAAGACGAAAGGCACTGACTGGATCGGGGAGGGGGACGGGCGGCGCAGACAACGTCGCCTT
CTTCGACGCCGGCGACGGCGCGCACCGGTCAACGGTGCCGATCGAGGAGATGACGTTCGGCGGGGCGCGCCGGCC
GTTCGAGGACGGGCTCGGGCTCGGCGACGCGCTCTACTCGTTCGGCATCAACTTCGCCGGCGCCATCACCAACAA
CAACTACCCGGCCTTCCTGCGGCGGCTGCACACGCCCGACGGGCAGGTGCGCGACCTGGGCAGCGTCGACATCGT
GCGCGACCGCGAGCGCGGCGTGCCGCGCTACAACCAGTTCCGGCGCCTGCTCGGGATGCGCGCGCCGGCCACGTT
CGAGGAGCTGACGGGCGGCGACGCCGGCCTGGCGCACGAGCTGCGCGAGGCCTACGCCGGCGACATCGAGGCCGT
CGACGCCCTCGTCGGCTCCCACAGCGAGCCGCTGCCGGCCGGCTTCGGCTTCAGCGAGACGGCCTTCCGCGTCTT
CATCGTCATGGCCAGCAGCCGGCTCAAGAGCGACCGCTTCTTCGCCGACCAGTGGAACGCCGAGACGTACAGCCC
CGAGGGCCTGCGCTGGGCCCAGGACACGTCCATGAAGGACATCCTCCTCCGCCACTGCCCGGAGCTGGCCGCCTC
GCTCGAGCGGGCCGACAACGTCTTCGCCCCCTGGGAGAAGCTGCCCAAGTCGAACAAGTACGACGGCGTCGAGAC
GAATGCCCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail