Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6557
Gene name
LocationContig_34:14666..15329
Strand-
Gene length (bp)663
Transcript length (bp)429
Coding sequence length (bp)429
Protein length (aa) 143

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 5 137 3.0E-10
sp|Q9US40|YFZ1_SCHPO Uncharacterized amino-acid permease C1039.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.01 PE=3 SV=1 1 137 2.0E-09
sp|P53744|BIO5_YEAST 7-keto 8-aminopelargonic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO5 PE=1 SV=1 6 137 3.0E-08
sp|O74537|YCQ4_SCHPO Uncharacterized amino-acid permease C74.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC74.04 PE=3 SV=1 7 132 4.0E-08
sp|Q10087|YAO8_SCHPO Uncharacterized amino-acid permease C11D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.08c PE=3 SV=1 5 137 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 5 137 3.0E-10
sp|Q9US40|YFZ1_SCHPO Uncharacterized amino-acid permease C1039.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.01 PE=3 SV=1 1 137 2.0E-09
sp|P53744|BIO5_YEAST 7-keto 8-aminopelargonic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO5 PE=1 SV=1 6 137 3.0E-08
sp|O74537|YCQ4_SCHPO Uncharacterized amino-acid permease C74.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC74.04 PE=3 SV=1 7 132 4.0E-08
sp|Q10087|YAO8_SCHPO Uncharacterized amino-acid permease C11D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.08c PE=3 SV=1 5 137 2.0E-07
sp|O59942|AAP2_NEUCR Amino-acid permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aap-2 PE=2 SV=2 6 137 2.0E-07
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 1 123 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 57 79 22
3 86 108 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6557
MFSWPKWVPILSWITGWINVAGWVALVATNALLSSQLIVGIISLLHPAYDAQRWHQFLIYVGLTFLSFVINAFLN
SLLPFIYRGAFVWSIGGFLLVCIVVLACASPNYSSASFVFGDLINRTGWPDGIAWLLGVSRPPSCPS*
Coding >Hirsu2|6557
ATGTTCTCGTGGCCGAAATGGGTGCCAATTCTGTCCTGGATCACCGGTTGGATCAACGTGGCCGGCTGGGTCGCT
CTCGTCGCCACCAATGCGCTTCTCTCGAGCCAGCTCATCGTCGGCATCATCTCCTTGCTGCATCCGGCCTACGAC
GCGCAGAGATGGCACCAGTTCCTCATCTACGTCGGCCTCACCTTCCTGTCCTTCGTCATCAATGCTTTCCTCAAC
TCTCTGCTGCCGTTCATCTACCGCGGAGCCTTCGTCTGGTCCATCGGCGGCTTTCTCCTCGTCTGCATCGTCGTG
CTTGCGTGCGCCTCGCCCAACTATAGCTCTGCGAGCTTCGTCTTTGGAGACCTGATCAACAGGACGGGATGGCCC
GATGGCATTGCCTGGCTGCTGGGGGTGAGCAGACCTCCGTCGTGCCCCAGTTAA
Transcript >Hirsu2|6557
ATGTTCTCGTGGCCGAAATGGGTGCCAATTCTGTCCTGGATCACCGGTTGGATCAACGTGGCCGGCTGGGTCGCT
CTCGTCGCCACCAATGCGCTTCTCTCGAGCCAGCTCATCGTCGGCATCATCTCCTTGCTGCATCCGGCCTACGAC
GCGCAGAGATGGCACCAGTTCCTCATCTACGTCGGCCTCACCTTCCTGTCCTTCGTCATCAATGCTTTCCTCAAC
TCTCTGCTGCCGTTCATCTACCGCGGAGCCTTCGTCTGGTCCATCGGCGGCTTTCTCCTCGTCTGCATCGTCGTG
CTTGCGTGCGCCTCGCCCAACTATAGCTCTGCGAGCTTCGTCTTTGGAGACCTGATCAACAGGACGGGATGGCCC
GATGGCATTGCCTGGCTGCTGGGGGTGAGCAGACCTCCGTCGTGCCCCAGTTAA
Gene >Hirsu2|6557
ATGTGTACGGGTCCGGGCACATTGCCCATCTGTCTTGCCATGGCTGGCTGACTGGACGACTCGAGTCTCGTGGCC
GAAATGGGTGCCAATTCTGTCCTGGATCACCGGTTGGATCAACGTGGCCGGCTGGGTTCGTCGCACCACCGCCGG
CTTTCGCCCTTCTCTGACATGCGGCTGCTGTCCAGGTCGCTCTCGTCGCCACCAATGCGCTTCTCTCGAGCCAGC
TCATCGTCGGCATCATCTCCTTGCTGCATCCGGTACCGAGCCCTCGTCTCCGTCCATCCGCGGTGCCTCGCTCGG
CTGACGCAGGCTTCAGGCCTACGACGCGCAGAGATGGCACCAGTTCCTCATCTACGTCGGCCTCACCTTCCTGTC
CTTCGTCATCAATGCTTTCCTCAACTCTCTGCTGCCGTTCATCTACCGCGGAGCCTTCGTCTGGTCCATCGGCGG
CTTTCTCCTCGTCTGCATCGTCGTGCTTGCGTGCGCCTCGCCCAACTATAGCTCTGCGAGCTTCGTCTTTGGAGA
CCTGATCAACAGGACGGGATGTAGGTCGGCCACATTCTTTTTGGGCCGACGCAGCGCAGCCCACTGAACCGCTTC
ACAGGGCCCGATGGCATTGCCTGGCTGCTGGGGGTGAGCAGACCTCCGTCGTGCCCCAGTTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail