Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6556
Gene name
LocationContig_34:13375..14519
Strand-
Gene length (bp)1144
Transcript length (bp)789
Coding sequence length (bp)789
Protein length (aa) 263

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 6.6E-30 2 224
PF00324 AA_permease Amino acid permease 3.1E-12 22 230

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 3 254 1.0E-35
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 20 241 8.0E-30
sp|O59942|AAP2_NEUCR Amino-acid permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aap-2 PE=2 SV=2 3 260 9.0E-26
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 1 244 3.0E-25
sp|Q9US40|YFZ1_SCHPO Uncharacterized amino-acid permease C1039.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.01 PE=3 SV=1 3 258 4.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 3 254 1.0E-35
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 20 241 8.0E-30
sp|O59942|AAP2_NEUCR Amino-acid permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aap-2 PE=2 SV=2 3 260 9.0E-26
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 1 244 3.0E-25
sp|Q9US40|YFZ1_SCHPO Uncharacterized amino-acid permease C1039.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.01 PE=3 SV=1 3 258 4.0E-19
sp|P36029|TPO5_YEAST Polyamine transporter TPO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO5 PE=1 SV=1 4 244 6.0E-19
sp|Q9C0Z0|YKM2_SCHPO Uncharacterized amino-acid permease PB24D3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.02c PE=3 SV=1 1 244 2.0E-17
sp|O74248|GPT1_CANAX Putative polyamine transporter OS=Candida albicans GN=GPT1 PE=3 SV=1 3 248 5.0E-17
sp|Q09887|YC9D_SCHPO Uncharacterized amino-acid permease C584.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.13 PE=3 SV=1 3 258 5.0E-16
sp|Q10087|YAO8_SCHPO Uncharacterized amino-acid permease C11D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.08c PE=3 SV=1 3 249 7.0E-16
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 1 249 1.0E-15
sp|P32837|UGA4_YEAST GABA-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA4 PE=1 SV=1 3 221 2.0E-15
sp|P53744|BIO5_YEAST 7-keto 8-aminopelargonic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO5 PE=1 SV=1 1 228 4.0E-14
sp|O59813|YCT3_SCHPO Uncharacterized amino-acid permease C794.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.03 PE=2 SV=1 3 234 2.0E-13
sp|O74537|YCQ4_SCHPO Uncharacterized amino-acid permease C74.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC74.04 PE=3 SV=1 1 248 4.0E-13
sp|Q9UT18|THI9_SCHPO Thiamine transporter thi9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi9 PE=1 SV=1 46 255 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0006810 transport No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide 0.1133 0.1589 0.0187 0.1412 0.1034 0.002 0.2657 0.6454 0.4318 0.0112

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 64 86 22
3 115 137 22
4 144 166 22
5 181 203 22
6 216 235 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup284
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1529
Ophiocordyceps australis map64 (Brazil) OphauB2|2590
Ophiocordyceps australis map64 (Brazil) OphauB2|3855
Ophiocordyceps camponoti-floridani Ophcf2|00544
Ophiocordyceps camponoti-floridani Ophcf2|00915
Ophiocordyceps camponoti-rufipedis Ophun1|503
Ophiocordyceps kimflemingae Ophio5|5532
Ophiocordyceps kimflemingae Ophio5|7648
Ophiocordyceps subramaniannii Hirsu2|4988
Ophiocordyceps subramaniannii Hirsu2|6556 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6556
MIEEIPHASIEGPKIMVLCVGIGTFTGAIFLIVLLFVSGRIQDVIDSSAGPLLQILYHATGSRAGAVSLLMLPLV
CLVFATLSVMTTSSRMIFAFARDGGLPASPFFARVHTRLGLPFNALVLNLVIVILFGLIFLGSTSAFNAIISASV
VALDLSYAMPIAVNCLRGRNTLPKRTWQLPAWFGWTADLVSLAYISLTTVLFLFPPQLPVTGTNMNYCIVAFAII
VAISAFQWIVDGRKNFTGPRVSLQVTSASVHSNAGSK*
Coding >Hirsu2|6556
ATGATCGAAGAGATCCCTCACGCGTCTATCGAGGGCCCTAAGATCATGGTCCTGTGCGTGGGCATCGGCACATTC
ACGGGGGCAATCTTCCTCATCGTGCTGCTGTTCGTCTCGGGCCGCATCCAGGACGTCATCGACTCCAGCGCCGGG
CCCCTTTTGCAGATTCTATACCACGCCACGGGGAGCCGTGCCGGTGCGGTGAGCCTGCTCATGCTTCCGCTCGTC
TGCCTCGTCTTCGCCACTTTGAGCGTCATGACGACGAGCAGTCGCATGATCTTTGCCTTTGCCCGAGACGGCGGC
CTCCCGGCCTCGCCCTTCTTTGCCCGGGTCCATACGCGGCTCGGACTGCCGTTCAACGCCCTGGTGCTCAACCTG
GTAATCGTGATCCTGTTCGGACTCATCTTTCTCGGCTCGACCAGTGCTTTCAACGCCATCATCTCCGCGTCCGTG
GTGGCGCTCGATCTGTCCTACGCGATGCCGATCGCCGTCAATTGCCTGAGGGGACGCAACACGTTGCCGAAGAGG
ACGTGGCAGTTGCCCGCTTGGTTCGGATGGACGGCAGACCTGGTATCTTTGGCCTACATCTCGCTGACGACGGTC
CTGTTTTTGTTCCCGCCCCAGCTCCCCGTCACCGGAACGAACATGAACTATTGCATCGTCGCCTTCGCCATCATA
GTCGCCATTTCGGCTTTCCAATGGATCGTGGACGGGCGGAAGAACTTTACAGGGCCCCGCGTCAGCCTCCAAGTT
ACCTCGGCATCGGTTCACTCCAATGCCGGTTCGAAGTAA
Transcript >Hirsu2|6556
ATGATCGAAGAGATCCCTCACGCGTCTATCGAGGGCCCTAAGATCATGGTCCTGTGCGTGGGCATCGGCACATTC
ACGGGGGCAATCTTCCTCATCGTGCTGCTGTTCGTCTCGGGCCGCATCCAGGACGTCATCGACTCCAGCGCCGGG
CCCCTTTTGCAGATTCTATACCACGCCACGGGGAGCCGTGCCGGTGCGGTGAGCCTGCTCATGCTTCCGCTCGTC
TGCCTCGTCTTCGCCACTTTGAGCGTCATGACGACGAGCAGTCGCATGATCTTTGCCTTTGCCCGAGACGGCGGC
CTCCCGGCCTCGCCCTTCTTTGCCCGGGTCCATACGCGGCTCGGACTGCCGTTCAACGCCCTGGTGCTCAACCTG
GTAATCGTGATCCTGTTCGGACTCATCTTTCTCGGCTCGACCAGTGCTTTCAACGCCATCATCTCCGCGTCCGTG
GTGGCGCTCGATCTGTCCTACGCGATGCCGATCGCCGTCAATTGCCTGAGGGGACGCAACACGTTGCCGAAGAGG
ACGTGGCAGTTGCCCGCTTGGTTCGGATGGACGGCAGACCTGGTATCTTTGGCCTACATCTCGCTGACGACGGTC
CTGTTTTTGTTCCCGCCCCAGCTCCCCGTCACCGGAACGAACATGAACTATTGCATCGTCGCCTTCGCCATCATA
GTCGCCATTTCGGCTTTCCAATGGATCGTGGACGGGCGGAAGAACTTTACAGGGCCCCGCGTCAGCCTCCAAGTT
ACCTCGGCATCGGTTCACTCCAATGCCGGTTCGAAGTAA
Gene >Hirsu2|6556
ATGATCGAAGGTGAGCTGGGAGCAGACTCGGCTGGCCTGTATCCTCTCCATGCGCCCTATTCCGTTGATCTCGGT
CTGACGCGGCCGGCCCTCGCTCAGAGATCCCTCACGCGTCTATCGAGGGCCCTAAGATCATGGTCCTGTGCGTGG
GCATCGGCACATTCACGGGGGCAATCTTCCTCATCGTGCTGCTGTTCGTCTCGGGCCGCATCCAGGACGTCATCG
ACTCCAGCGCCGGGCCCCTTTTGCAGATTCTATACCACGCCACGGGGAGCCGTGCCGGTGCGGTGAGCCTGCTCA
TGTACGTCGTGCCGTCGTGTCGTCTTTTCTCCCAGGTCAGGGACAGGGACCGGAGTTGACCTGCTCGGAGGCTTC
CGCTCGTCTGCCTCGTCTTCGCCACTTTGAGCGTCATGACGACGAGCAGTCGCATGATCTTTGCCTTTGCCCGGT
ACGTTGCGATGGCGCCAACGCAATTTGCTCCTCATGTGTCGGTCCTCCATCAGTACTGATCACGTGGCCTCAGAG
ACGGCGGCCTCCCGGCCTCGCCCTTCTTTGCCCGGGTCCATACGCGGCTCGGACTGCCGTTCAACGCCCTGGTGC
TCAACCTGGTAATCGTGATCCTGTTCGGACTCATCTTTCTCGGCTCGACCAGGTGCGCACGTTGCCGACGAGAGC
AAGCCCAGCTCATGTGCTGATGCACGGTGTCCAGTGCTTTCAACGCCATCATCTCCGCGTCCGTGGTGGCGCTCG
ATCTGTCCTACGCGATGCCGATCGCCGTCAATTGCCTGAGGGGACGCAACACGTTGCCGAAGAGGACGTGGCAGT
TGCCCGCTTGGTTCGGATGGACGGCAGACCTGGTATCTTTGGCCTACATCTCGCTGACGACGGTCCTGTTTTTGT
TCCCGCCCCAGCTCCCCGTCACCGGAACGAACATGAGTATGTCTCGCCCACGAAGGCACGAGGCGTCGGGTGTGT
CGGCTACTAACGTTGTACGGCCCCAGACTATTGCATCGTCGCCTTCGCCATCATAGTCGCCATTTCGGCTTTCCA
ATGGATCGTGGACGGGCGGAAGAACTTTACAGGGCCCCGCGTCAGCCTCCAAGTTACCTCGGCATCGGTTCACTC
CAATGCCGGTTCGAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail