Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6553
Gene name
LocationContig_34:4970..5675
Strand-
Gene length (bp)705
Transcript length (bp)705
Coding sequence length (bp)705
Protein length (aa) 235

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B3R7|A3106_ARTBC Extracellular protein ARB_03106 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03106 PE=1 SV=1 3 234 4.0E-62

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1047 0.0414 0.7312 0.142 0.2096 0.2051 0.3846 0.3766 0.2318 0.0199

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.866842

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7090
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6766
Ophiocordyceps australis map64 (Brazil) OphauB2|7599
Ophiocordyceps subramaniannii Hirsu2|6553 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6553
MRRLARLLGAAAGLSAVAAGSWGDDDLEVPSLDVRRCPTMGAANFSIEMPELTRSFPRTWVLLCYTSDNLHLEFD
ALDEKYFYDDPWQGTNGDIIAYEVLVALIAKGADDPLTYFEFEVNPSNVTYQAYVHNPSKTRAENQPFGRFIVEE
PEQTGIRAFTSLNRWDKRWAVSVRLPLSLFNVGRGEGWGTHWRMNFFRTVVGPESWPKQRLGGWSPPNLAEFHMT
QFFGRVKFL*
Coding >Hirsu2|6553
ATGCGTCGACTCGCCCGTCTCCTGGGCGCGGCCGCCGGGCTGAGCGCCGTCGCGGCCGGCAGCTGGGGCGACGAC
GACCTGGAGGTGCCGTCGCTCGACGTCCGGCGGTGCCCGACCATGGGCGCGGCCAACTTCAGCATCGAGATGCCG
GAGCTGACGCGCAGCTTCCCGAGGACGTGGGTGCTGCTCTGCTACACCAGCGACAACCTGCACCTCGAGTTCGAC
GCCCTGGACGAGAAGTACTTCTACGACGACCCGTGGCAGGGCACCAACGGCGACATCATCGCGTACGAGGTGCTG
GTGGCCCTCATCGCCAAGGGCGCCGACGACCCGCTGACCTACTTCGAGTTCGAGGTCAACCCCAGCAACGTGACG
TACCAGGCCTACGTGCACAACCCGAGCAAGACCCGGGCCGAGAACCAGCCGTTCGGCCGGTTCATCGTCGAGGAG
CCGGAGCAGACGGGCATCCGCGCCTTCACCTCGCTCAACCGCTGGGACAAGCGCTGGGCCGTCAGCGTCCGCCTC
CCGCTCTCGCTCTTCAACGTCGGCCGCGGCGAGGGCTGGGGCACCCACTGGCGCATGAACTTCTTCCGCACCGTC
GTCGGGCCCGAAAGCTGGCCCAAGCAGAGGCTCGGCGGCTGGAGCCCGCCCAACCTGGCCGAGTTCCACATGACC
CAGTTCTTTGGCCGCGTCAAGTTTCTCTGA
Transcript >Hirsu2|6553
ATGCGTCGACTCGCCCGTCTCCTGGGCGCGGCCGCCGGGCTGAGCGCCGTCGCGGCCGGCAGCTGGGGCGACGAC
GACCTGGAGGTGCCGTCGCTCGACGTCCGGCGGTGCCCGACCATGGGCGCGGCCAACTTCAGCATCGAGATGCCG
GAGCTGACGCGCAGCTTCCCGAGGACGTGGGTGCTGCTCTGCTACACCAGCGACAACCTGCACCTCGAGTTCGAC
GCCCTGGACGAGAAGTACTTCTACGACGACCCGTGGCAGGGCACCAACGGCGACATCATCGCGTACGAGGTGCTG
GTGGCCCTCATCGCCAAGGGCGCCGACGACCCGCTGACCTACTTCGAGTTCGAGGTCAACCCCAGCAACGTGACG
TACCAGGCCTACGTGCACAACCCGAGCAAGACCCGGGCCGAGAACCAGCCGTTCGGCCGGTTCATCGTCGAGGAG
CCGGAGCAGACGGGCATCCGCGCCTTCACCTCGCTCAACCGCTGGGACAAGCGCTGGGCCGTCAGCGTCCGCCTC
CCGCTCTCGCTCTTCAACGTCGGCCGCGGCGAGGGCTGGGGCACCCACTGGCGCATGAACTTCTTCCGCACCGTC
GTCGGGCCCGAAAGCTGGCCCAAGCAGAGGCTCGGCGGCTGGAGCCCGCCCAACCTGGCCGAGTTCCACATGACC
CAGTTCTTTGGCCGCGTCAAGTTTCTCTGA
Gene >Hirsu2|6553
ATGCGTCGACTCGCCCGTCTCCTGGGCGCGGCCGCCGGGCTGAGCGCCGTCGCGGCCGGCAGCTGGGGCGACGAC
GACCTGGAGGTGCCGTCGCTCGACGTCCGGCGGTGCCCGACCATGGGCGCGGCCAACTTCAGCATCGAGATGCCG
GAGCTGACGCGCAGCTTCCCGAGGACGTGGGTGCTGCTCTGCTACACCAGCGACAACCTGCACCTCGAGTTCGAC
GCCCTGGACGAGAAGTACTTCTACGACGACCCGTGGCAGGGCACCAACGGCGACATCATCGCGTACGAGGTGCTG
GTGGCCCTCATCGCCAAGGGCGCCGACGACCCGCTGACCTACTTCGAGTTCGAGGTCAACCCCAGCAACGTGACG
TACCAGGCCTACGTGCACAACCCGAGCAAGACCCGGGCCGAGAACCAGCCGTTCGGCCGGTTCATCGTCGAGGAG
CCGGAGCAGACGGGCATCCGCGCCTTCACCTCGCTCAACCGCTGGGACAAGCGCTGGGCCGTCAGCGTCCGCCTC
CCGCTCTCGCTCTTCAACGTCGGCCGCGGCGAGGGCTGGGGCACCCACTGGCGCATGAACTTCTTCCGCACCGTC
GTCGGGCCCGAAAGCTGGCCCAAGCAGAGGCTCGGCGGCTGGAGCCCGCCCAACCTGGCCGAGTTCCACATGACC
CAGTTCTTTGGCCGCGTCAAGTTTCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail