Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6553
Gene name
LocationContig_34:4970..5675
Strand-
Gene length (bp)705
Transcript length (bp)705
Coding sequence length (bp)705
Protein length (aa) 235

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B3R7|A3106_ARTBC Extracellular protein ARB_03106 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03106 PE=1 SV=1 3 234 4.0E-62

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6553
MRRLARLLGAAAGLSAVAAGSWGDDDLEVPSLDVRRCPTMGAANFSIEMPELTRSFPRTWVLLCYTSDNLHLEFD
ALDEKYFYDDPWQGTNGDIIAYEVLVALIAKGADDPLTYFEFEVNPSNVTYQAYVHNPSKTRAENQPFGRFIVEE
PEQTGIRAFTSLNRWDKRWAVSVRLPLSLFNVGRGEGWGTHWRMNFFRTVVGPESWPKQRLGGWSPPNLAEFHMT
QFFGRVKFL*
Coding >Hirsu2|6553
ATGCGTCGACTCGCCCGTCTCCTGGGCGCGGCCGCCGGGCTGAGCGCCGTCGCGGCCGGCAGCTGGGGCGACGAC
GACCTGGAGGTGCCGTCGCTCGACGTCCGGCGGTGCCCGACCATGGGCGCGGCCAACTTCAGCATCGAGATGCCG
GAGCTGACGCGCAGCTTCCCGAGGACGTGGGTGCTGCTCTGCTACACCAGCGACAACCTGCACCTCGAGTTCGAC
GCCCTGGACGAGAAGTACTTCTACGACGACCCGTGGCAGGGCACCAACGGCGACATCATCGCGTACGAGGTGCTG
GTGGCCCTCATCGCCAAGGGCGCCGACGACCCGCTGACCTACTTCGAGTTCGAGGTCAACCCCAGCAACGTGACG
TACCAGGCCTACGTGCACAACCCGAGCAAGACCCGGGCCGAGAACCAGCCGTTCGGCCGGTTCATCGTCGAGGAG
CCGGAGCAGACGGGCATCCGCGCCTTCACCTCGCTCAACCGCTGGGACAAGCGCTGGGCCGTCAGCGTCCGCCTC
CCGCTCTCGCTCTTCAACGTCGGCCGCGGCGAGGGCTGGGGCACCCACTGGCGCATGAACTTCTTCCGCACCGTC
GTCGGGCCCGAAAGCTGGCCCAAGCAGAGGCTCGGCGGCTGGAGCCCGCCCAACCTGGCCGAGTTCCACATGACC
CAGTTCTTTGGCCGCGTCAAGTTTCTCTGA
Transcript >Hirsu2|6553
ATGCGTCGACTCGCCCGTCTCCTGGGCGCGGCCGCCGGGCTGAGCGCCGTCGCGGCCGGCAGCTGGGGCGACGAC
GACCTGGAGGTGCCGTCGCTCGACGTCCGGCGGTGCCCGACCATGGGCGCGGCCAACTTCAGCATCGAGATGCCG
GAGCTGACGCGCAGCTTCCCGAGGACGTGGGTGCTGCTCTGCTACACCAGCGACAACCTGCACCTCGAGTTCGAC
GCCCTGGACGAGAAGTACTTCTACGACGACCCGTGGCAGGGCACCAACGGCGACATCATCGCGTACGAGGTGCTG
GTGGCCCTCATCGCCAAGGGCGCCGACGACCCGCTGACCTACTTCGAGTTCGAGGTCAACCCCAGCAACGTGACG
TACCAGGCCTACGTGCACAACCCGAGCAAGACCCGGGCCGAGAACCAGCCGTTCGGCCGGTTCATCGTCGAGGAG
CCGGAGCAGACGGGCATCCGCGCCTTCACCTCGCTCAACCGCTGGGACAAGCGCTGGGCCGTCAGCGTCCGCCTC
CCGCTCTCGCTCTTCAACGTCGGCCGCGGCGAGGGCTGGGGCACCCACTGGCGCATGAACTTCTTCCGCACCGTC
GTCGGGCCCGAAAGCTGGCCCAAGCAGAGGCTCGGCGGCTGGAGCCCGCCCAACCTGGCCGAGTTCCACATGACC
CAGTTCTTTGGCCGCGTCAAGTTTCTCTGA
Gene >Hirsu2|6553
ATGCGTCGACTCGCCCGTCTCCTGGGCGCGGCCGCCGGGCTGAGCGCCGTCGCGGCCGGCAGCTGGGGCGACGAC
GACCTGGAGGTGCCGTCGCTCGACGTCCGGCGGTGCCCGACCATGGGCGCGGCCAACTTCAGCATCGAGATGCCG
GAGCTGACGCGCAGCTTCCCGAGGACGTGGGTGCTGCTCTGCTACACCAGCGACAACCTGCACCTCGAGTTCGAC
GCCCTGGACGAGAAGTACTTCTACGACGACCCGTGGCAGGGCACCAACGGCGACATCATCGCGTACGAGGTGCTG
GTGGCCCTCATCGCCAAGGGCGCCGACGACCCGCTGACCTACTTCGAGTTCGAGGTCAACCCCAGCAACGTGACG
TACCAGGCCTACGTGCACAACCCGAGCAAGACCCGGGCCGAGAACCAGCCGTTCGGCCGGTTCATCGTCGAGGAG
CCGGAGCAGACGGGCATCCGCGCCTTCACCTCGCTCAACCGCTGGGACAAGCGCTGGGCCGTCAGCGTCCGCCTC
CCGCTCTCGCTCTTCAACGTCGGCCGCGGCGAGGGCTGGGGCACCCACTGGCGCATGAACTTCTTCCGCACCGTC
GTCGGGCCCGAAAGCTGGCCCAAGCAGAGGCTCGGCGGCTGGAGCCCGCCCAACCTGGCCGAGTTCCACATGACC
CAGTTCTTTGGCCGCGTCAAGTTTCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail