Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6550
Gene name
LocationContig_3397:143..990
Strand-
Gene length (bp)847
Transcript length (bp)678
Coding sequence length (bp)678
Protein length (aa) 226

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03907 Spo7 Spo7-like protein 2.8E-66 49 195

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USQ0|SPO7_SCHPO Sporulation-specific protein spo7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spo7 PE=3 SV=1 45 173 3.0E-17
sp|P18410|SPO7_YEAST Sporulation-specific protein SPO7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO7 PE=1 SV=1 29 182 2.0E-13

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 81 98 17
2 118 140 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6550
MADDLDSIVKGAPVPAAAASVAHSVKGGQGTGTTPMAGKLGDPLNHAPSSPSMVYLNLLILEASLRAQFLELRAR
RRHHTFFLTLLTLWVAFFGYQLYLAPREDGRGVGGSIYWAVEGAQRVCFMGGIITAVLVWATGIWDRGIRWPRRW
FAISNRGLRAFNCKLVVVGRPWWAEALSTVGFFLTYGLFSHTASSSPSRPPSARTGSCTGPSTGSARTSAAPCCA
*
Coding >Hirsu2|6550
ATGGCCGACGACCTCGACTCCATCGTCAAGGGCGCGCCCGTGCCCGCCGCCGCCGCCAGCGTCGCGCACAGCGTC
AAGGGCGGCCAAGGGACGGGCACGACGCCGATGGCCGGCAAGCTCGGCGACCCGCTCAACCACGCGCCCAGCTCG
CCGTCCATGGTCTACCTGAACCTGCTGATCCTCGAGGCGTCGCTGCGGGCGCAGTTCCTCGAGCTGCGCGCCCGG
CGGCGCCACCACACCTTCTTCCTCACCCTGCTGACGCTCTGGGTCGCCTTCTTCGGCTACCAGCTCTACCTGGCG
CCGCGCGAGGACGGCCGCGGCGTCGGCGGCTCCATCTACTGGGCCGTCGAGGGCGCGCAGCGGGTGTGCTTCATG
GGCGGCATCATCACGGCCGTCCTGGTCTGGGCCACGGGCATCTGGGACCGCGGCATCCGCTGGCCGCGCCGCTGG
TTCGCCATCTCCAACCGCGGCCTGCGCGCCTTCAACTGCAAGCTCGTCGTCGTCGGCCGCCCGTGGTGGGCCGAG
GCCCTCTCCACCGTCGGCTTCTTCCTCACCTACGGCCTCTTCTCCCACACCGCCAGCTCCTCCCCTTCTCGCCCA
CCTTCCGCGAGAACTGGGAGCTGTACCGGACCGAGTACTGGGAGCGCGAGAACGAGCGCCGCGCCGTGCTGCGCC
TAA
Transcript >Hirsu2|6550
ATGGCCGACGACCTCGACTCCATCGTCAAGGGCGCGCCCGTGCCCGCCGCCGCCGCCAGCGTCGCGCACAGCGTC
AAGGGCGGCCAAGGGACGGGCACGACGCCGATGGCCGGCAAGCTCGGCGACCCGCTCAACCACGCGCCCAGCTCG
CCGTCCATGGTCTACCTGAACCTGCTGATCCTCGAGGCGTCGCTGCGGGCGCAGTTCCTCGAGCTGCGCGCCCGG
CGGCGCCACCACACCTTCTTCCTCACCCTGCTGACGCTCTGGGTCGCCTTCTTCGGCTACCAGCTCTACCTGGCG
CCGCGCGAGGACGGCCGCGGCGTCGGCGGCTCCATCTACTGGGCCGTCGAGGGCGCGCAGCGGGTGTGCTTCATG
GGCGGCATCATCACGGCCGTCCTGGTCTGGGCCACGGGCATCTGGGACCGCGGCATCCGCTGGCCGCGCCGCTGG
TTCGCCATCTCCAACCGCGGCCTGCGCGCCTTCAACTGCAAGCTCGTCGTCGTCGGCCGCCCGTGGTGGGCCGAG
GCCCTCTCCACCGTCGGCTTCTTCCTCACCTACGGCCTCTTCTCCCACACCGCCAGCTCCTCCCCTTCTCGCCCA
CCTTCCGCGAGAACTGGGAGCTGTACCGGACCGAGTACTGGGAGCGCGAGAACGAGCGCCGCGCCGTGCTGCGCC
TAA
Gene >Hirsu2|6550
ATGGCCGACGACCTCGACTCCATCGTCAAGGGCGCGCCCGTGCCCGCCGCCGCCGCCAGCGTCGCGCACAGCGTC
AAGGGCGGCCAAGGGACGGGCACGACGCCGATGGCCGGCAAGCTCGGCGACCCGCTCAACCACGCGCCCAGCTCG
CCGTCCATGGTCTACCTGAACCTGCTGATCCTCGAGGCGTCGCTGCGGGCGCAGTTCCTCGAGCTGCGCGCCCGG
CGGCGCCACCACACCTTCTTCCTCACCCTGCTGACGCTCTGGGTCGCCTTCTTCGGCTACCAGCTCTACCTGGCG
CCGCGCGAGGACGGCCGCGGCGTCGGCGGCTCCATCTACTGGGCCGTCGAGGGCGCGCAGCGGGTGTGCTTCATG
GGCGGCATCATCACGGCCGTCCTGGTCTGGGCCACGGGCATCTGGGACCGCGGCATCCGCTGGCCGCGCCGCTGG
TTCGCCATCTCCAACCGCGGCCTGCGCGCCTTCAACTGCAAGCTCGTCGTCGTCGGCCGCCCGTGGTGGGCCGAG
GCCCTCTCCACCGTCGGCTTCTTCCTCACCTACGGCCTCTTCTCCCACACCGCCAGCTCCTCGTACCGCCACGTC
GACCCGGCCCTGCTGCGCGAGGCGGAGAAGGAGCTGCAGCCGGCGCCCGACGGCCACCCGACCCTGGTCCTGCCG
CCCGACGACGAGGAGCAGGCCGGCCACGAGGAGGACCTGGCCCCCGGCGGCGACTACGTCAAGCTGCTGCTGCTG
GCCAAGCCCTTCTCGCCCACCTTCCGCGAGAACTGGGAGCTGTACCGGACCGAGTACTGGGAGCGCGAGAACGAG
CGCCGCGCCGTGCTGCGCCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail