Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|655
Gene name
LocationContig_113:29921..32295
Strand+
Gene length (bp)2374
Transcript length (bp)2100
Coding sequence length (bp)2100
Protein length (aa) 700

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C5FL47|MEP7_ARTOC Extracellular metalloprotease MCYG_03238 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_03238 PE=3 SV=1 499 639 6.0E-12
sp|E4V4I7|MEP6_ARTGP Extracellular metalloprotease MGYG_07913 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_07913 PE=3 SV=1 494 635 2.0E-10
sp|C5FQJ4|MEP6_ARTOC Extracellular metalloprotease MCYG_04966 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04966 PE=3 SV=1 494 635 5.0E-10
sp|D4DI84|MEP6_TRIVH Extracellular metalloprotease TRV_06892 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06892 PE=3 SV=2 494 635 6.0E-10
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 502 635 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C5FL47|MEP7_ARTOC Extracellular metalloprotease MCYG_03238 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_03238 PE=3 SV=1 499 639 6.0E-12
sp|E4V4I7|MEP6_ARTGP Extracellular metalloprotease MGYG_07913 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_07913 PE=3 SV=1 494 635 2.0E-10
sp|C5FQJ4|MEP6_ARTOC Extracellular metalloprotease MCYG_04966 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04966 PE=3 SV=1 494 635 5.0E-10
sp|D4DI84|MEP6_TRIVH Extracellular metalloprotease TRV_06892 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06892 PE=3 SV=2 494 635 6.0E-10
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 502 635 1.0E-09
sp|D4ALW9|MEP6_ARTBC Extracellular metalloprotease ARB_05317 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05317 PE=1 SV=1 494 635 1.0E-09
sp|B2AC45|MEP1_PODAN Extracellular metalloprotease PODANS_2_14170 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_2_14170 PE=3 SV=1 491 635 5.0E-08
sp|E4USP0|MEP8_ARTGP Extracellular metalloprotease MGYG_03559 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_03559 PE=3 SV=1 472 635 6.0E-08
sp|D4DIV0|MEP7_TRIVH Extracellular metalloprotease TRV_07111 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_07111 PE=3 SV=1 502 643 1.0E-07
sp|D4ATD1|MEP7_ARTBC Extracellular metalloprotease ARB_07495 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07495 PE=3 SV=1 502 643 1.0E-07
sp|C5P3X6|MEP1_COCP7 Extracellular metalloprotease 1 OS=Coccidioides posadasii (strain C735) GN=MEP1 PE=1 SV=1 494 639 3.0E-07
sp|C4K014|MEP1_UNCRE Extracellular metalloprotease UREG_07765 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_07765 PE=3 SV=1 502 635 3.0E-07
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1965 0.1025 0.8232 0.209 0.1522 0.0663 0.1892 0.3016 0.2849 0.0148

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999711

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup90
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1200
Ophiocordyceps australis 1348a (Ghana) OphauG2|357
Ophiocordyceps australis 1348a (Ghana) OphauG2|358
Ophiocordyceps australis 1348a (Ghana) OphauG2|7035
Ophiocordyceps australis map64 (Brazil) OphauB2|1559
Ophiocordyceps australis map64 (Brazil) OphauB2|342
Ophiocordyceps australis map64 (Brazil) OphauB2|5213
Ophiocordyceps australis map64 (Brazil) OphauB2|5232
Ophiocordyceps australis map64 (Brazil) OphauB2|6499
Ophiocordyceps australis map64 (Brazil) OphauB2|6500
Ophiocordyceps australis map64 (Brazil) OphauB2|993
Ophiocordyceps camponoti-floridani Ophcf2|05949
Ophiocordyceps camponoti-rufipedis Ophun1|2840
Ophiocordyceps kimflemingae Ophio5|3518
Ophiocordyceps subramaniannii Hirsu2|655 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|655
MEGLVRVLLLLGVLCKGGTATEDCSELECYEDLVFLTGSAPRLFSQCVNGALTQGETVTTYCDATCPAQRCNGRE
DGVVSVEPAQFKRVCSCVTSKAVPWHCEDLRCYHEMASLAGDSPYRLRRRCLSKQMFGFDSTLTHPKSIFPFEVD
CGRPTDDGSEILIGKEDYGPVCECVLGADGSSVRRWPASRAVLGRQDGFEPLFMDAFIHIIVKSSDHVYLSNMPE
FFERGFRQTSDELKRLGIIPIVKSVQAIVQPEWALGRDNAGMRESLHQGDNRDLNFYLLVSSNLDDRREMIRPLN
ASRNTYCSPPFESTAWETKTERETDQDGCISTPFINNTAEVDGAALSRWLGLCEGVGCKELPSQYPDKEVHDSLA
KSRFVPTPRDLTRTTSHLKAHDKKQDVCHDMPCYRELKWLLPGPTNLDEHCRFYRQTASPTNLNGDIPFRNASFP
FFITCGTVSSDSWLITMKEYLHVCHCAVEYDAPPRQVRTIDVFADADDKLPIVIDVFIHAISASRDGPMARKFHN
KAELETEFRRAAAFYKPAMIAFRLKSVDLTVNAIWASGNDSDGMRQSLYAGGTRDLNLYYLEAPDLERAVDTVNA
TLVFCSFPFSSWWAYLSLSDPEHDGCLVPMRATPGLLAAAMQYWIGVHLPAPRACKEPECGPRFSSEDIGLMRRL
LALNRFIPLTSKWARLRLLGIKGI*
Coding >Hirsu2|655
ATGGAGGGCCTCGTCCGTGTCCTGCTTCTGCTCGGCGTCCTGTGCAAGGGCGGGACGGCGACGGAGGACTGCTCG
GAGCTCGAGTGCTACGAGGACCTGGTCTTCCTGACCGGGTCGGCGCCGCGGCTCTTCAGCCAGTGCGTCAACGGC
GCGCTGACGCAGGGCGAGACGGTGACGACGTACTGCGACGCGACGTGCCCGGCGCAGCGGTGCAACGGGCGGGAG
GACGGCGTCGTGTCGGTCGAGCCGGCGCAGTTCAAGCGCGTGTGCAGCTGCGTGACGAGCAAGGCGGTGCCGTGG
CACTGCGAAGACCTGCGCTGCTATCACGAGATGGCGTCGCTGGCCGGGGACTCGCCGTACCGGCTGCGGCGGCGC
TGCCTGTCCAAGCAGATGTTCGGCTTCGATAGCACGCTGACGCACCCCAAGAGCATCTTCCCCTTCGAAGTCGAC
TGCGGCCGGCCGACCGACGACGGCTCCGAGATCCTGATCGGCAAGGAAGACTACGGGCCCGTCTGCGAGTGCGTG
CTCGGCGCCGACGGGAGCTCCGTCCGGCGCTGGCCCGCCAGCCGCGCCGTCCTGGGCCGGCAGGACGGCTTCGAG
CCCCTCTTCATGGACGCCTTCATCCATATCATCGTCAAATCGTCCGATCACGTCTACCTGTCCAACATGCCGGAA
TTCTTCGAGCGCGGCTTCCGCCAGACGAGCGACGAGCTGAAGCGGCTGGGCATCATTCCCATCGTCAAGTCGGTC
CAGGCCATCGTCCAGCCCGAGTGGGCGCTGGGCCGCGACAACGCCGGCATGCGCGAGAGCCTGCACCAGGGCGAC
AATCGCGACCTCAACTTCTACCTGCTCGTCAGCTCGAACCTCGACGACCGGCGCGAGATGATCCGGCCGCTGAAC
GCGTCGAGGAACACGTACTGCTCGCCGCCCTTCGAGTCGACCGCGTGGGAGACGAAGACGGAGAGGGAGACGGAC
CAGGACGGCTGTATCTCGACGCCGTTCATCAACAACACGGCCGAGGTCGACGGCGCCGCCCTATCGCGCTGGCTC
GGCCTGTGCGAAGGAGTAGGCTGTAAAGAGTTGCCGAGCCAATATCCAGACAAGGAGGTGCACGACAGCCTGGCC
AAGTCGCGCTTCGTGCCGACCCCCAGGGATCTGACGAGGACCACCTCGCACCTGAAGGCGCACGACAAGAAGCAG
GACGTCTGCCATGACATGCCGTGCTATCGCGAGCTGAAGTGGCTGCTGCCGGGCCCGACCAACCTGGACGAGCAC
TGCCGCTTCTACCGGCAGACGGCCAGCCCGACGAACCTCAACGGCGACATACCCTTCCGCAACGCCAGCTTCCCC
TTCTTCATCACGTGCGGGACCGTGTCGTCGGACAGCTGGCTGATCACGATGAAGGAGTATCTGCACGTCTGCCAC
TGCGCCGTCGAGTACGACGCGCCGCCTCGCCAGGTGCGCACGATAGACGTCTTTGCCGACGCCGACGACAAGCTG
CCCATCGTCATCGACGTCTTCATCCACGCCATCTCGGCCTCGAGAGACGGGCCCATGGCCAGGAAGTTCCACAAC
AAGGCCGAGCTCGAGACCGAGTTCCGGCGGGCGGCCGCCTTCTACAAGCCGGCCATGATCGCGTTCCGGCTCAAG
TCGGTCGACCTGACCGTCAACGCCATCTGGGCCAGCGGCAACGACAGCGACGGCATGCGCCAGTCGCTCTACGCC
GGCGGCACCCGCGACCTCAACCTCTACTACCTCGAGGCGCCCGACCTCGAGCGCGCCGTCGACACCGTCAACGCC
ACCCTCGTCTTCTGCTCCTTTCCCTTCTCCTCCTGGTGGGCCTACCTGTCGCTCAGCGATCCCGAGCACGACGGC
TGCCTCGTGCCCATGCGGGCGACGCCGGGCCTGCTGGCGGCCGCGATGCAGTACTGGATCGGCGTCCATCTGCCG
GCCCCGCGGGCCTGCAAGGAGCCCGAGTGCGGGCCCAGGTTCAGCTCCGAGGACATTGGCCTGATGCGTCGTCTG
CTCGCCCTCAACCGCTTCATCCCCCTCACCAGCAAGTGGGCCAGGCTGCGTCTCCTCGGCATCAAGGGTATCTGA
Transcript >Hirsu2|655
ATGGAGGGCCTCGTCCGTGTCCTGCTTCTGCTCGGCGTCCTGTGCAAGGGCGGGACGGCGACGGAGGACTGCTCG
GAGCTCGAGTGCTACGAGGACCTGGTCTTCCTGACCGGGTCGGCGCCGCGGCTCTTCAGCCAGTGCGTCAACGGC
GCGCTGACGCAGGGCGAGACGGTGACGACGTACTGCGACGCGACGTGCCCGGCGCAGCGGTGCAACGGGCGGGAG
GACGGCGTCGTGTCGGTCGAGCCGGCGCAGTTCAAGCGCGTGTGCAGCTGCGTGACGAGCAAGGCGGTGCCGTGG
CACTGCGAAGACCTGCGCTGCTATCACGAGATGGCGTCGCTGGCCGGGGACTCGCCGTACCGGCTGCGGCGGCGC
TGCCTGTCCAAGCAGATGTTCGGCTTCGATAGCACGCTGACGCACCCCAAGAGCATCTTCCCCTTCGAAGTCGAC
TGCGGCCGGCCGACCGACGACGGCTCCGAGATCCTGATCGGCAAGGAAGACTACGGGCCCGTCTGCGAGTGCGTG
CTCGGCGCCGACGGGAGCTCCGTCCGGCGCTGGCCCGCCAGCCGCGCCGTCCTGGGCCGGCAGGACGGCTTCGAG
CCCCTCTTCATGGACGCCTTCATCCATATCATCGTCAAATCGTCCGATCACGTCTACCTGTCCAACATGCCGGAA
TTCTTCGAGCGCGGCTTCCGCCAGACGAGCGACGAGCTGAAGCGGCTGGGCATCATTCCCATCGTCAAGTCGGTC
CAGGCCATCGTCCAGCCCGAGTGGGCGCTGGGCCGCGACAACGCCGGCATGCGCGAGAGCCTGCACCAGGGCGAC
AATCGCGACCTCAACTTCTACCTGCTCGTCAGCTCGAACCTCGACGACCGGCGCGAGATGATCCGGCCGCTGAAC
GCGTCGAGGAACACGTACTGCTCGCCGCCCTTCGAGTCGACCGCGTGGGAGACGAAGACGGAGAGGGAGACGGAC
CAGGACGGCTGTATCTCGACGCCGTTCATCAACAACACGGCCGAGGTCGACGGCGCCGCCCTATCGCGCTGGCTC
GGCCTGTGCGAAGGAGTAGGCTGTAAAGAGTTGCCGAGCCAATATCCAGACAAGGAGGTGCACGACAGCCTGGCC
AAGTCGCGCTTCGTGCCGACCCCCAGGGATCTGACGAGGACCACCTCGCACCTGAAGGCGCACGACAAGAAGCAG
GACGTCTGCCATGACATGCCGTGCTATCGCGAGCTGAAGTGGCTGCTGCCGGGCCCGACCAACCTGGACGAGCAC
TGCCGCTTCTACCGGCAGACGGCCAGCCCGACGAACCTCAACGGCGACATACCCTTCCGCAACGCCAGCTTCCCC
TTCTTCATCACGTGCGGGACCGTGTCGTCGGACAGCTGGCTGATCACGATGAAGGAGTATCTGCACGTCTGCCAC
TGCGCCGTCGAGTACGACGCGCCGCCTCGCCAGGTGCGCACGATAGACGTCTTTGCCGACGCCGACGACAAGCTG
CCCATCGTCATCGACGTCTTCATCCACGCCATCTCGGCCTCGAGAGACGGGCCCATGGCCAGGAAGTTCCACAAC
AAGGCCGAGCTCGAGACCGAGTTCCGGCGGGCGGCCGCCTTCTACAAGCCGGCCATGATCGCGTTCCGGCTCAAG
TCGGTCGACCTGACCGTCAACGCCATCTGGGCCAGCGGCAACGACAGCGACGGCATGCGCCAGTCGCTCTACGCC
GGCGGCACCCGCGACCTCAACCTCTACTACCTCGAGGCGCCCGACCTCGAGCGCGCCGTCGACACCGTCAACGCC
ACCCTCGTCTTCTGCTCCTTTCCCTTCTCCTCCTGGTGGGCCTACCTGTCGCTCAGCGATCCCGAGCACGACGGC
TGCCTCGTGCCCATGCGGGCGACGCCGGGCCTGCTGGCGGCCGCGATGCAGTACTGGATCGGCGTCCATCTGCCG
GCCCCGCGGGCCTGCAAGGAGCCCGAGTGCGGGCCCAGGTTCAGCTCCGAGGACATTGGCCTGATGCGTCGTCTG
CTCGCCCTCAACCGCTTCATCCCCCTCACCAGCAAGTGGGCCAGGCTGCGTCTCCTCGGCATCAAGGGTATCTGA
Gene >Hirsu2|655
ATGGAGGGCCTCGTCCGTGTCCTGCTTCTGCTCGGCGTCCTGTGCAAGGGCGGGACGGCGACGGAGGACTGCTCG
GAGCTCGAGTGCTACGAGGACCTGGTCTTCCTGACCGGGTCGGCGCCGCGGCTCTTCAGCCAGTGCGTCAACGGC
GCGCTGACGCAGGGCGAGACGGTGACGACGTACTGCGACGCGACGTGCCCGGCGCAGCGGTGCAACGGGCGGGAG
GACGGCGTCGTGTCGGTCGAGCCGGCGCAGTTCAAGCGCGTGTGCAGCTGCGTGACGAGCAAGGCGGTGCCGTGG
CACTGCGAAGACCTGCGCTGCTATCACGAGATGGCGTCGCTGGCCGGGGACTCGCCGTACCGGCTGCGGCGGCGC
TGCCTGTCCAAGCAGATGTTCGGCTTCGATAGCACGCTGACGCACCCCAAGAGCATCTTCCCCTTCGAAGTCGAC
TGCGGCCGGCCGACCGACGACGGCTCCGAGATCCTGATCGGCAAGGAAGACTACGGGCCCGTCTGCGAGTGCGTG
CTCGGCGCCGACGGGAGCTCCGTCCGGCGCTGGCCCGCCAGCCGCGCCGTCCTGGGCCGGCAGGACGGCTTCGAG
CCCCTCTTCATGGACGCCTTCATCCATATCATCGTCAAATCGTCCGATCACGTCTACCTGGTACGTGGCCCCCGG
CGTTGAGGATTCCATGTAGACGATGCCGTCGTGAGACCATGTTTGATATTCACACCCGATGGCCGTGCTCCCGCA
GTCCAACATGCCGGAATTCTTCGAGCGCGGCTTCCGCCAGACGAGCGACGAGCTGAAGCGGCTGGGCATCATTCC
CATCGTCAAGTCGGTCCAGGCCATCGTCCAGCCCGAGTGGGCGCTGGGCCGCGACAACGCCGGCATGCGCGAGAG
CCTGCACCAGGGCGACAATCGCGACCTCAACTTCTACCTGCTCGTCAGCTCGAACCTCGACGACCGGCGCGAGAT
GATCCGGCCGCTGAACGCGTCGAGGAACACGTACTGCTCGCCGCCCTTCGAGTCGACCGCGTGGGAGACGAAGAC
GGAGAGGGAGACGGACCAGGACGGCTGTATCTCGACGCCGTTCATCAACAACACGGCCGAGGTCGACGGCGCCGC
CCTATCGCGCTGGCTCGGCCTGTGCGAAGGAGTGTAAGCAGAAAGCGGACGGGAGAGTCGATCGAGACGGTTCCG
CGGTCGGGGCTGACGGGAAGCGTCTTTCGTCCAGAGGCTGTAAAGAGTTGCCGAGCCAATATCCAGACAAGGAGG
TGCACGACAGCCTGGCCAAGTCGCGCTTCGTGCCGACCCCCAGGGATCTGACGAGGACCACCTCGCACCTGAAGG
CGCACGACAAGAAGCAGGACGTCTGCCATGACATGCCGTGCTATCGCGAGCTGAAGTGGCTGCTGCCGGGCCCGA
CCAACCTGGACGAGCACTGCCGCTTCTACCGGCAGACGGCCAGCCCGACGAACCTCAACGGCGACATACCCTTCC
GCAACGCCAGCTTCCCCTTCTTCATCACGTGCGGGACCGTGTCGTCGGACAGCTGGCTGATCACGATGAAGGAGT
ATCTGCACGTCTGCCACTGCGCCGTCGAGTACGACGCGCCGCCTCGCCAGGTGCGCACGATAGACGTCTTTGCCG
ACGCCGACGACAAGCTGCCCATCGTCATCGACGTCTTCATCCACGCCATCTCGGCCTCGAGAGACGGGCCCATGG
CCAGGAAGGTCAGTCCTCTCGCCGCTCCGCCGCCATTTTCATAAAAAAAAAAAGAAAATCAAAGAATGAAAATCA
AACCAAAAAGGGGTAACGTGTGTCCGAGCCCCTATTCCAGTTCCACAACAAGGCCGAGCTCGAGACCGAGTTCCG
GCGGGCGGCCGCCTTCTACAAGCCGGCCATGATCGCGTTCCGGCTCAAGTCGGTCGACCTGACCGTCAACGCCAT
CTGGGCCAGCGGCAACGACAGCGACGGCATGCGCCAGTCGCTCTACGCCGGCGGCACCCGCGACCTCAACCTCTA
CTACCTCGAGGCGCCCGACCTCGAGCGCGCCGTCGACACCGTCAACGCCACCCTCGTCTTCTGCTCCTTTCCCTT
CTCCTCCTGGTGGGCCTACCTGTCGCTCAGCGATCCCGAGCACGACGGCTGCCTCGTGCCCATGCGGGCGACGCC
GGGCCTGCTGGCGGCCGCGATGCAGTACTGGATCGGCGTCCATCTGCCGGCCCCGCGGGCCTGCAAGGAGCCCGA
GTGCGGGCCCAGGTTCAGCTCCGAGGACATTGGCCTGATGCGTCGTCTGCTCGCCCTCAACCGCTTCATCCCCCT
CACCAGCAAGTGGGCCAGGCTGCGTCTCCTCGGCATCAAGGGTATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail