Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|655
Gene name
LocationContig_113:29921..32295
Strand+
Gene length (bp)2374
Transcript length (bp)2100
Coding sequence length (bp)2100
Protein length (aa) 700

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C5FL47|MEP7_ARTOC Extracellular metalloprotease MCYG_03238 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_03238 PE=3 SV=1 499 639 6.0E-12
sp|E4V4I7|MEP6_ARTGP Extracellular metalloprotease MGYG_07913 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_07913 PE=3 SV=1 494 635 2.0E-10
sp|C5FQJ4|MEP6_ARTOC Extracellular metalloprotease MCYG_04966 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04966 PE=3 SV=1 494 635 5.0E-10
sp|D4DI84|MEP6_TRIVH Extracellular metalloprotease TRV_06892 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06892 PE=3 SV=2 494 635 6.0E-10
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 502 635 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C5FL47|MEP7_ARTOC Extracellular metalloprotease MCYG_03238 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_03238 PE=3 SV=1 499 639 6.0E-12
sp|E4V4I7|MEP6_ARTGP Extracellular metalloprotease MGYG_07913 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_07913 PE=3 SV=1 494 635 2.0E-10
sp|C5FQJ4|MEP6_ARTOC Extracellular metalloprotease MCYG_04966 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04966 PE=3 SV=1 494 635 5.0E-10
sp|D4DI84|MEP6_TRIVH Extracellular metalloprotease TRV_06892 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06892 PE=3 SV=2 494 635 6.0E-10
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 502 635 1.0E-09
sp|D4ALW9|MEP6_ARTBC Extracellular metalloprotease ARB_05317 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05317 PE=1 SV=1 494 635 1.0E-09
sp|B2AC45|MEP1_PODAN Extracellular metalloprotease PODANS_2_14170 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_2_14170 PE=3 SV=1 491 635 5.0E-08
sp|E4USP0|MEP8_ARTGP Extracellular metalloprotease MGYG_03559 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_03559 PE=3 SV=1 472 635 6.0E-08
sp|D4DIV0|MEP7_TRIVH Extracellular metalloprotease TRV_07111 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_07111 PE=3 SV=1 502 643 1.0E-07
sp|D4ATD1|MEP7_ARTBC Extracellular metalloprotease ARB_07495 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07495 PE=3 SV=1 502 643 1.0E-07
sp|C5P3X6|MEP1_COCP7 Extracellular metalloprotease 1 OS=Coccidioides posadasii (strain C735) GN=MEP1 PE=1 SV=1 494 639 3.0E-07
sp|C4K014|MEP1_UNCRE Extracellular metalloprotease UREG_07765 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_07765 PE=3 SV=1 502 635 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|655
MEGLVRVLLLLGVLCKGGTATEDCSELECYEDLVFLTGSAPRLFSQCVNGALTQGETVTTYCDATCPAQRCNGRE
DGVVSVEPAQFKRVCSCVTSKAVPWHCEDLRCYHEMASLAGDSPYRLRRRCLSKQMFGFDSTLTHPKSIFPFEVD
CGRPTDDGSEILIGKEDYGPVCECVLGADGSSVRRWPASRAVLGRQDGFEPLFMDAFIHIIVKSSDHVYLSNMPE
FFERGFRQTSDELKRLGIIPIVKSVQAIVQPEWALGRDNAGMRESLHQGDNRDLNFYLLVSSNLDDRREMIRPLN
ASRNTYCSPPFESTAWETKTERETDQDGCISTPFINNTAEVDGAALSRWLGLCEGVGCKELPSQYPDKEVHDSLA
KSRFVPTPRDLTRTTSHLKAHDKKQDVCHDMPCYRELKWLLPGPTNLDEHCRFYRQTASPTNLNGDIPFRNASFP
FFITCGTVSSDSWLITMKEYLHVCHCAVEYDAPPRQVRTIDVFADADDKLPIVIDVFIHAISASRDGPMARKFHN
KAELETEFRRAAAFYKPAMIAFRLKSVDLTVNAIWASGNDSDGMRQSLYAGGTRDLNLYYLEAPDLERAVDTVNA
TLVFCSFPFSSWWAYLSLSDPEHDGCLVPMRATPGLLAAAMQYWIGVHLPAPRACKEPECGPRFSSEDIGLMRRL
LALNRFIPLTSKWARLRLLGIKGI*
Coding >Hirsu2|655
ATGGAGGGCCTCGTCCGTGTCCTGCTTCTGCTCGGCGTCCTGTGCAAGGGCGGGACGGCGACGGAGGACTGCTCG
GAGCTCGAGTGCTACGAGGACCTGGTCTTCCTGACCGGGTCGGCGCCGCGGCTCTTCAGCCAGTGCGTCAACGGC
GCGCTGACGCAGGGCGAGACGGTGACGACGTACTGCGACGCGACGTGCCCGGCGCAGCGGTGCAACGGGCGGGAG
GACGGCGTCGTGTCGGTCGAGCCGGCGCAGTTCAAGCGCGTGTGCAGCTGCGTGACGAGCAAGGCGGTGCCGTGG
CACTGCGAAGACCTGCGCTGCTATCACGAGATGGCGTCGCTGGCCGGGGACTCGCCGTACCGGCTGCGGCGGCGC
TGCCTGTCCAAGCAGATGTTCGGCTTCGATAGCACGCTGACGCACCCCAAGAGCATCTTCCCCTTCGAAGTCGAC
TGCGGCCGGCCGACCGACGACGGCTCCGAGATCCTGATCGGCAAGGAAGACTACGGGCCCGTCTGCGAGTGCGTG
CTCGGCGCCGACGGGAGCTCCGTCCGGCGCTGGCCCGCCAGCCGCGCCGTCCTGGGCCGGCAGGACGGCTTCGAG
CCCCTCTTCATGGACGCCTTCATCCATATCATCGTCAAATCGTCCGATCACGTCTACCTGTCCAACATGCCGGAA
TTCTTCGAGCGCGGCTTCCGCCAGACGAGCGACGAGCTGAAGCGGCTGGGCATCATTCCCATCGTCAAGTCGGTC
CAGGCCATCGTCCAGCCCGAGTGGGCGCTGGGCCGCGACAACGCCGGCATGCGCGAGAGCCTGCACCAGGGCGAC
AATCGCGACCTCAACTTCTACCTGCTCGTCAGCTCGAACCTCGACGACCGGCGCGAGATGATCCGGCCGCTGAAC
GCGTCGAGGAACACGTACTGCTCGCCGCCCTTCGAGTCGACCGCGTGGGAGACGAAGACGGAGAGGGAGACGGAC
CAGGACGGCTGTATCTCGACGCCGTTCATCAACAACACGGCCGAGGTCGACGGCGCCGCCCTATCGCGCTGGCTC
GGCCTGTGCGAAGGAGTAGGCTGTAAAGAGTTGCCGAGCCAATATCCAGACAAGGAGGTGCACGACAGCCTGGCC
AAGTCGCGCTTCGTGCCGACCCCCAGGGATCTGACGAGGACCACCTCGCACCTGAAGGCGCACGACAAGAAGCAG
GACGTCTGCCATGACATGCCGTGCTATCGCGAGCTGAAGTGGCTGCTGCCGGGCCCGACCAACCTGGACGAGCAC
TGCCGCTTCTACCGGCAGACGGCCAGCCCGACGAACCTCAACGGCGACATACCCTTCCGCAACGCCAGCTTCCCC
TTCTTCATCACGTGCGGGACCGTGTCGTCGGACAGCTGGCTGATCACGATGAAGGAGTATCTGCACGTCTGCCAC
TGCGCCGTCGAGTACGACGCGCCGCCTCGCCAGGTGCGCACGATAGACGTCTTTGCCGACGCCGACGACAAGCTG
CCCATCGTCATCGACGTCTTCATCCACGCCATCTCGGCCTCGAGAGACGGGCCCATGGCCAGGAAGTTCCACAAC
AAGGCCGAGCTCGAGACCGAGTTCCGGCGGGCGGCCGCCTTCTACAAGCCGGCCATGATCGCGTTCCGGCTCAAG
TCGGTCGACCTGACCGTCAACGCCATCTGGGCCAGCGGCAACGACAGCGACGGCATGCGCCAGTCGCTCTACGCC
GGCGGCACCCGCGACCTCAACCTCTACTACCTCGAGGCGCCCGACCTCGAGCGCGCCGTCGACACCGTCAACGCC
ACCCTCGTCTTCTGCTCCTTTCCCTTCTCCTCCTGGTGGGCCTACCTGTCGCTCAGCGATCCCGAGCACGACGGC
TGCCTCGTGCCCATGCGGGCGACGCCGGGCCTGCTGGCGGCCGCGATGCAGTACTGGATCGGCGTCCATCTGCCG
GCCCCGCGGGCCTGCAAGGAGCCCGAGTGCGGGCCCAGGTTCAGCTCCGAGGACATTGGCCTGATGCGTCGTCTG
CTCGCCCTCAACCGCTTCATCCCCCTCACCAGCAAGTGGGCCAGGCTGCGTCTCCTCGGCATCAAGGGTATCTGA
Transcript >Hirsu2|655
ATGGAGGGCCTCGTCCGTGTCCTGCTTCTGCTCGGCGTCCTGTGCAAGGGCGGGACGGCGACGGAGGACTGCTCG
GAGCTCGAGTGCTACGAGGACCTGGTCTTCCTGACCGGGTCGGCGCCGCGGCTCTTCAGCCAGTGCGTCAACGGC
GCGCTGACGCAGGGCGAGACGGTGACGACGTACTGCGACGCGACGTGCCCGGCGCAGCGGTGCAACGGGCGGGAG
GACGGCGTCGTGTCGGTCGAGCCGGCGCAGTTCAAGCGCGTGTGCAGCTGCGTGACGAGCAAGGCGGTGCCGTGG
CACTGCGAAGACCTGCGCTGCTATCACGAGATGGCGTCGCTGGCCGGGGACTCGCCGTACCGGCTGCGGCGGCGC
TGCCTGTCCAAGCAGATGTTCGGCTTCGATAGCACGCTGACGCACCCCAAGAGCATCTTCCCCTTCGAAGTCGAC
TGCGGCCGGCCGACCGACGACGGCTCCGAGATCCTGATCGGCAAGGAAGACTACGGGCCCGTCTGCGAGTGCGTG
CTCGGCGCCGACGGGAGCTCCGTCCGGCGCTGGCCCGCCAGCCGCGCCGTCCTGGGCCGGCAGGACGGCTTCGAG
CCCCTCTTCATGGACGCCTTCATCCATATCATCGTCAAATCGTCCGATCACGTCTACCTGTCCAACATGCCGGAA
TTCTTCGAGCGCGGCTTCCGCCAGACGAGCGACGAGCTGAAGCGGCTGGGCATCATTCCCATCGTCAAGTCGGTC
CAGGCCATCGTCCAGCCCGAGTGGGCGCTGGGCCGCGACAACGCCGGCATGCGCGAGAGCCTGCACCAGGGCGAC
AATCGCGACCTCAACTTCTACCTGCTCGTCAGCTCGAACCTCGACGACCGGCGCGAGATGATCCGGCCGCTGAAC
GCGTCGAGGAACACGTACTGCTCGCCGCCCTTCGAGTCGACCGCGTGGGAGACGAAGACGGAGAGGGAGACGGAC
CAGGACGGCTGTATCTCGACGCCGTTCATCAACAACACGGCCGAGGTCGACGGCGCCGCCCTATCGCGCTGGCTC
GGCCTGTGCGAAGGAGTAGGCTGTAAAGAGTTGCCGAGCCAATATCCAGACAAGGAGGTGCACGACAGCCTGGCC
AAGTCGCGCTTCGTGCCGACCCCCAGGGATCTGACGAGGACCACCTCGCACCTGAAGGCGCACGACAAGAAGCAG
GACGTCTGCCATGACATGCCGTGCTATCGCGAGCTGAAGTGGCTGCTGCCGGGCCCGACCAACCTGGACGAGCAC
TGCCGCTTCTACCGGCAGACGGCCAGCCCGACGAACCTCAACGGCGACATACCCTTCCGCAACGCCAGCTTCCCC
TTCTTCATCACGTGCGGGACCGTGTCGTCGGACAGCTGGCTGATCACGATGAAGGAGTATCTGCACGTCTGCCAC
TGCGCCGTCGAGTACGACGCGCCGCCTCGCCAGGTGCGCACGATAGACGTCTTTGCCGACGCCGACGACAAGCTG
CCCATCGTCATCGACGTCTTCATCCACGCCATCTCGGCCTCGAGAGACGGGCCCATGGCCAGGAAGTTCCACAAC
AAGGCCGAGCTCGAGACCGAGTTCCGGCGGGCGGCCGCCTTCTACAAGCCGGCCATGATCGCGTTCCGGCTCAAG
TCGGTCGACCTGACCGTCAACGCCATCTGGGCCAGCGGCAACGACAGCGACGGCATGCGCCAGTCGCTCTACGCC
GGCGGCACCCGCGACCTCAACCTCTACTACCTCGAGGCGCCCGACCTCGAGCGCGCCGTCGACACCGTCAACGCC
ACCCTCGTCTTCTGCTCCTTTCCCTTCTCCTCCTGGTGGGCCTACCTGTCGCTCAGCGATCCCGAGCACGACGGC
TGCCTCGTGCCCATGCGGGCGACGCCGGGCCTGCTGGCGGCCGCGATGCAGTACTGGATCGGCGTCCATCTGCCG
GCCCCGCGGGCCTGCAAGGAGCCCGAGTGCGGGCCCAGGTTCAGCTCCGAGGACATTGGCCTGATGCGTCGTCTG
CTCGCCCTCAACCGCTTCATCCCCCTCACCAGCAAGTGGGCCAGGCTGCGTCTCCTCGGCATCAAGGGTATCTGA
Gene >Hirsu2|655
ATGGAGGGCCTCGTCCGTGTCCTGCTTCTGCTCGGCGTCCTGTGCAAGGGCGGGACGGCGACGGAGGACTGCTCG
GAGCTCGAGTGCTACGAGGACCTGGTCTTCCTGACCGGGTCGGCGCCGCGGCTCTTCAGCCAGTGCGTCAACGGC
GCGCTGACGCAGGGCGAGACGGTGACGACGTACTGCGACGCGACGTGCCCGGCGCAGCGGTGCAACGGGCGGGAG
GACGGCGTCGTGTCGGTCGAGCCGGCGCAGTTCAAGCGCGTGTGCAGCTGCGTGACGAGCAAGGCGGTGCCGTGG
CACTGCGAAGACCTGCGCTGCTATCACGAGATGGCGTCGCTGGCCGGGGACTCGCCGTACCGGCTGCGGCGGCGC
TGCCTGTCCAAGCAGATGTTCGGCTTCGATAGCACGCTGACGCACCCCAAGAGCATCTTCCCCTTCGAAGTCGAC
TGCGGCCGGCCGACCGACGACGGCTCCGAGATCCTGATCGGCAAGGAAGACTACGGGCCCGTCTGCGAGTGCGTG
CTCGGCGCCGACGGGAGCTCCGTCCGGCGCTGGCCCGCCAGCCGCGCCGTCCTGGGCCGGCAGGACGGCTTCGAG
CCCCTCTTCATGGACGCCTTCATCCATATCATCGTCAAATCGTCCGATCACGTCTACCTGGTACGTGGCCCCCGG
CGTTGAGGATTCCATGTAGACGATGCCGTCGTGAGACCATGTTTGATATTCACACCCGATGGCCGTGCTCCCGCA
GTCCAACATGCCGGAATTCTTCGAGCGCGGCTTCCGCCAGACGAGCGACGAGCTGAAGCGGCTGGGCATCATTCC
CATCGTCAAGTCGGTCCAGGCCATCGTCCAGCCCGAGTGGGCGCTGGGCCGCGACAACGCCGGCATGCGCGAGAG
CCTGCACCAGGGCGACAATCGCGACCTCAACTTCTACCTGCTCGTCAGCTCGAACCTCGACGACCGGCGCGAGAT
GATCCGGCCGCTGAACGCGTCGAGGAACACGTACTGCTCGCCGCCCTTCGAGTCGACCGCGTGGGAGACGAAGAC
GGAGAGGGAGACGGACCAGGACGGCTGTATCTCGACGCCGTTCATCAACAACACGGCCGAGGTCGACGGCGCCGC
CCTATCGCGCTGGCTCGGCCTGTGCGAAGGAGTGTAAGCAGAAAGCGGACGGGAGAGTCGATCGAGACGGTTCCG
CGGTCGGGGCTGACGGGAAGCGTCTTTCGTCCAGAGGCTGTAAAGAGTTGCCGAGCCAATATCCAGACAAGGAGG
TGCACGACAGCCTGGCCAAGTCGCGCTTCGTGCCGACCCCCAGGGATCTGACGAGGACCACCTCGCACCTGAAGG
CGCACGACAAGAAGCAGGACGTCTGCCATGACATGCCGTGCTATCGCGAGCTGAAGTGGCTGCTGCCGGGCCCGA
CCAACCTGGACGAGCACTGCCGCTTCTACCGGCAGACGGCCAGCCCGACGAACCTCAACGGCGACATACCCTTCC
GCAACGCCAGCTTCCCCTTCTTCATCACGTGCGGGACCGTGTCGTCGGACAGCTGGCTGATCACGATGAAGGAGT
ATCTGCACGTCTGCCACTGCGCCGTCGAGTACGACGCGCCGCCTCGCCAGGTGCGCACGATAGACGTCTTTGCCG
ACGCCGACGACAAGCTGCCCATCGTCATCGACGTCTTCATCCACGCCATCTCGGCCTCGAGAGACGGGCCCATGG
CCAGGAAGGTCAGTCCTCTCGCCGCTCCGCCGCCATTTTCATAAAAAAAAAAAGAAAATCAAAGAATGAAAATCA
AACCAAAAAGGGGTAACGTGTGTCCGAGCCCCTATTCCAGTTCCACAACAAGGCCGAGCTCGAGACCGAGTTCCG
GCGGGCGGCCGCCTTCTACAAGCCGGCCATGATCGCGTTCCGGCTCAAGTCGGTCGACCTGACCGTCAACGCCAT
CTGGGCCAGCGGCAACGACAGCGACGGCATGCGCCAGTCGCTCTACGCCGGCGGCACCCGCGACCTCAACCTCTA
CTACCTCGAGGCGCCCGACCTCGAGCGCGCCGTCGACACCGTCAACGCCACCCTCGTCTTCTGCTCCTTTCCCTT
CTCCTCCTGGTGGGCCTACCTGTCGCTCAGCGATCCCGAGCACGACGGCTGCCTCGTGCCCATGCGGGCGACGCC
GGGCCTGCTGGCGGCCGCGATGCAGTACTGGATCGGCGTCCATCTGCCGGCCCCGCGGGCCTGCAAGGAGCCCGA
GTGCGGGCCCAGGTTCAGCTCCGAGGACATTGGCCTGATGCGTCGTCTGCTCGCCCTCAACCGCTTCATCCCCCT
CACCAGCAAGTGGGCCAGGCTGCGTCTCCTCGGCATCAAGGGTATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail