Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6549
Gene name
LocationContig_3396:86..983
Strand-
Gene length (bp)897
Transcript length (bp)897
Coding sequence length (bp)897
Protein length (aa) 299

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03291 Pox_MCEL mRNA capping enzyme 2.6E-18 25 115
PF03291 Pox_MCEL mRNA capping enzyme 2.5E-19 178 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4R8D7|MCES_MAGO7 mRNA cap guanine-N7 methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ABD1 PE=3 SV=1 21 298 3.0E-116
sp|Q4WN42|MCES_ASPFU mRNA cap guanine-N7 methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=abd1 PE=3 SV=1 4 298 3.0E-98
sp|A1DMG9|MCES_NEOFI mRNA cap guanine-N7 methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=abd1 PE=3 SV=1 4 298 4.0E-98
sp|Q2UM19|MCES_ASPOR mRNA cap guanine-N7 methyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abd1 PE=3 SV=1 24 298 8.0E-97
sp|A1CT57|MCES_ASPCL mRNA cap guanine-N7 methyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=abd1 PE=3 SV=1 2 298 6.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4R8D7|MCES_MAGO7 mRNA cap guanine-N7 methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ABD1 PE=3 SV=1 21 298 3.0E-116
sp|Q4WN42|MCES_ASPFU mRNA cap guanine-N7 methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=abd1 PE=3 SV=1 4 298 3.0E-98
sp|A1DMG9|MCES_NEOFI mRNA cap guanine-N7 methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=abd1 PE=3 SV=1 4 298 4.0E-98
sp|Q2UM19|MCES_ASPOR mRNA cap guanine-N7 methyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abd1 PE=3 SV=1 24 298 8.0E-97
sp|A1CT57|MCES_ASPCL mRNA cap guanine-N7 methyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=abd1 PE=3 SV=1 2 298 6.0E-96
sp|A2QVS9|MCES_ASPNC mRNA cap guanine-N7 methyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=abd1 PE=3 SV=1 174 298 6.0E-51
sp|Q6CC11|MCES_YARLI mRNA cap guanine-N7 methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ABD1 PE=3 SV=1 19 298 3.0E-41
sp|O74880|MCES_SCHPO mRNA cap guanine-N7 methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcm1 PE=1 SV=2 25 297 6.0E-36
sp|Q5ADX5|MCES_CANAL mRNA cap guanine-N7 methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ABD1 PE=3 SV=1 25 298 5.0E-30
sp|A5E032|MCES_LODEL mRNA cap guanine-N7 methyltransferase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ABD1 PE=3 SV=1 25 298 1.0E-27
sp|A2QVS9|MCES_ASPNC mRNA cap guanine-N7 methyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=abd1 PE=3 SV=1 24 112 6.0E-26
sp|A3GEV2|MCES_PICST mRNA cap guanine-N7 methyltransferase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ABD1 PE=3 SV=1 180 298 5.0E-22
sp|Q6CKI0|MCES_KLULA mRNA cap guanine-N7 methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ABD1 PE=3 SV=1 33 298 3.0E-21
sp|Q6Z9U7|MCES1_ORYSJ mRNA cap guanine-N7 methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os08g0180000 PE=2 SV=1 10 297 2.0E-20
sp|A5DDJ4|MCES_PICGU mRNA cap guanine-N7 methyltransferase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ABD1 PE=3 SV=2 180 298 4.0E-20
sp|Q6BMH4|MCES_DEBHA mRNA cap guanine-N7 methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ABD1 PE=3 SV=2 180 298 6.0E-18
sp|P0CO65|MCES_CRYNB mRNA cap guanine-N7 methyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ABD1 PE=3 SV=1 181 298 1.0E-16
sp|P0CO64|MCES_CRYNJ mRNA cap guanine-N7 methyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ABD1 PE=3 SV=1 181 298 1.0E-16
sp|A5DDJ4|MCES_PICGU mRNA cap guanine-N7 methyltransferase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ABD1 PE=3 SV=2 10 110 3.0E-13
sp|P32783|MCES_YEAST mRNA cap guanine-N7 methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABD1 PE=1 SV=1 181 298 3.0E-13
sp|P0CO64|MCES_CRYNJ mRNA cap guanine-N7 methyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ABD1 PE=3 SV=1 25 106 5.0E-13
sp|P0CO65|MCES_CRYNB mRNA cap guanine-N7 methyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ABD1 PE=3 SV=1 25 106 5.0E-13
sp|Q754U7|MCES_ASHGO mRNA cap guanine-N7 methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ABD1 PE=3 SV=1 181 298 1.0E-12
sp|Q6FML4|MCES_CANGA mRNA cap guanine-N7 methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ABD1 PE=3 SV=1 25 113 8.0E-12
sp|Q61E36|MCES_CAEBR mRNA cap guanine-N7 methyltransferase OS=Caenorhabditis briggsae GN=tag-72 PE=3 SV=1 19 112 1.0E-11
sp|P32783|MCES_YEAST mRNA cap guanine-N7 methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABD1 PE=1 SV=1 33 113 2.0E-11
sp|Q9XVS1|MCES_CAEEL mRNA cap guanine-N7 methyltransferase OS=Caenorhabditis elegans GN=tag-72 PE=3 SV=2 18 104 3.0E-11
sp|Q9LHQ7|MCES1_ARATH mRNA cap guanine-N7 methyltransferase 1 OS=Arabidopsis thaliana GN=At3g20650 PE=2 SV=1 180 297 9.0E-11
sp|Q754U7|MCES_ASHGO mRNA cap guanine-N7 methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ABD1 PE=3 SV=1 33 117 4.0E-10
sp|Q9D0L8|MCES_MOUSE mRNA cap guanine-N7 methyltransferase OS=Mus musculus GN=Rnmt PE=1 SV=1 19 110 9.0E-10
sp|Q1MTD3|MCES_DANRE mRNA cap guanine-N7 methyltransferase OS=Danio rerio GN=rnmt PE=3 SV=1 17 112 1.0E-09
sp|Q6FML4|MCES_CANGA mRNA cap guanine-N7 methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ABD1 PE=3 SV=1 180 298 1.0E-09
sp|Q6BMH4|MCES_DEBHA mRNA cap guanine-N7 methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ABD1 PE=3 SV=2 25 110 4.0E-09
sp|Q9D0L8|MCES_MOUSE mRNA cap guanine-N7 methyltransferase OS=Mus musculus GN=Rnmt PE=1 SV=1 174 271 2.0E-08
sp|O43148|MCES_HUMAN mRNA cap guanine-N7 methyltransferase OS=Homo sapiens GN=RNMT PE=1 SV=1 174 270 2.0E-08
sp|Q4R7K1|MCES_MACFA mRNA cap guanine-N7 methyltransferase OS=Macaca fascicularis GN=RNMT PE=2 SV=1 174 270 2.0E-08
sp|Q5U2U7|MCES_RAT mRNA cap guanine-N7 methyltransferase OS=Rattus norvegicus GN=Rnmt PE=1 SV=1 174 270 2.0E-08
sp|Q9LHQ7|MCES1_ARATH mRNA cap guanine-N7 methyltransferase 1 OS=Arabidopsis thaliana GN=At3g20650 PE=2 SV=1 60 112 3.0E-08
sp|Q5U2U7|MCES_RAT mRNA cap guanine-N7 methyltransferase OS=Rattus norvegicus GN=Rnmt PE=1 SV=1 19 110 9.0E-08
sp|Q28FT4|MCES_XENTR mRNA cap guanine-N7 methyltransferase OS=Xenopus tropicalis GN=rnmt PE=2 SV=1 174 270 2.0E-07
sp|Q9I8S2|MCES_XENLA mRNA cap guanine-N7 methyltransferase OS=Xenopus laevis GN=rnmt PE=2 SV=1 174 270 4.0E-07
sp|Q8SR66|MCES_ENCCU mRNA cap guanine-N7 methyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ABD1 PE=1 SV=2 17 112 7.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6549
MSARGGRGGRGGGGPGRGRPPPRLFDARFHVKDCYGESIEDVEIVRQVGFDPSPLNRRGFDVVSLLFSMHYAFES
EARARTMLRNVAGALKKGGRFIGCIPNSDVLGERVRQFNEKAAARRKGAAAAAAPTTEDGAQDGTGGSGDGDAKP
PPPAAATTTTQEEEPEDGELEEGEAEPTAEWGNSIYRVRFPGKTPEDGVFRPAFGWKYSFFLDEAVEEVPEYVVP
WEAFRALAEDFNLELQFHRTFPEIWEAEKDDAELGPLSERMGVRERGGAGRLLVTDEEMEAASFYIGFCFYKV*
Coding >Hirsu2|6549
ATGAGCGCCCGCGGCGGGCGCGGCGGCCGGGGCGGCGGCGGCCCCGGCCGAGGCCGGCCGCCGCCGCGCCTGTTC
GACGCGCGCTTCCACGTCAAGGACTGCTACGGCGAGTCGATCGAGGACGTCGAGATCGTTCGGCAGGTCGGCTTC
GACCCGTCGCCCCTGAACCGCCGCGGCTTCGACGTCGTCAGCCTGCTGTTCTCCATGCACTACGCCTTCGAGTCC
GAGGCCCGTGCCCGCACCATGCTGCGCAACGTGGCCGGCGCCCTCAAAAAGGGCGGCCGCTTCATCGGCTGCATC
CCCAACTCGGACGTCCTCGGCGAGCGCGTCCGCCAGTTCAACGAGAAGGCGGCGGCGAGGCGCAAGGGCGCCGCC
GCCGCCGCCGCCCCGACAACCGAGGACGGCGCCCAGGACGGCACCGGCGGCAGCGGCGACGGCGACGCAAAACCC
CCCCCTCCCGCCGCCGCCACCACCACCACCCAGGAGGAGGAGCCCGAGGACGGCGAGCTGGAGGAGGGCGAGGCG
GAGCCGACGGCGGAGTGGGGCAACTCGATCTACCGCGTGCGCTTCCCCGGCAAGACGCCCGAGGACGGCGTCTTC
CGGCCGGCCTTTGGCTGGAAGTACAGCTTCTTCCTTGACGAGGCCGTCGAGGAGGTGCCCGAGTATGTCGTTCCC
TGGGAGGCCTTCCGCGCCCTGGCCGAGGACTTCAACCTCGAGCTGCAGTTCCACCGCACCTTCCCCGAGATCTGG
GAGGCCGAGAAGGACGACGCCGAGCTCGGCCCGCTCAGCGAGCGCATGGGCGTCCGCGAGCGCGGCGGCGCCGGC
CGCCTGCTCGTCACCGACGAGGAGATGGAGGCCGCCAGCTTCTACATCGGCTTCTGCTTCTACAAGGTCTGA
Transcript >Hirsu2|6549
ATGAGCGCCCGCGGCGGGCGCGGCGGCCGGGGCGGCGGCGGCCCCGGCCGAGGCCGGCCGCCGCCGCGCCTGTTC
GACGCGCGCTTCCACGTCAAGGACTGCTACGGCGAGTCGATCGAGGACGTCGAGATCGTTCGGCAGGTCGGCTTC
GACCCGTCGCCCCTGAACCGCCGCGGCTTCGACGTCGTCAGCCTGCTGTTCTCCATGCACTACGCCTTCGAGTCC
GAGGCCCGTGCCCGCACCATGCTGCGCAACGTGGCCGGCGCCCTCAAAAAGGGCGGCCGCTTCATCGGCTGCATC
CCCAACTCGGACGTCCTCGGCGAGCGCGTCCGCCAGTTCAACGAGAAGGCGGCGGCGAGGCGCAAGGGCGCCGCC
GCCGCCGCCGCCCCGACAACCGAGGACGGCGCCCAGGACGGCACCGGCGGCAGCGGCGACGGCGACGCAAAACCC
CCCCCTCCCGCCGCCGCCACCACCACCACCCAGGAGGAGGAGCCCGAGGACGGCGAGCTGGAGGAGGGCGAGGCG
GAGCCGACGGCGGAGTGGGGCAACTCGATCTACCGCGTGCGCTTCCCCGGCAAGACGCCCGAGGACGGCGTCTTC
CGGCCGGCCTTTGGCTGGAAGTACAGCTTCTTCCTTGACGAGGCCGTCGAGGAGGTGCCCGAGTATGTCGTTCCC
TGGGAGGCCTTCCGCGCCCTGGCCGAGGACTTCAACCTCGAGCTGCAGTTCCACCGCACCTTCCCCGAGATCTGG
GAGGCCGAGAAGGACGACGCCGAGCTCGGCCCGCTCAGCGAGCGCATGGGCGTCCGCGAGCGCGGCGGCGCCGGC
CGCCTGCTCGTCACCGACGAGGAGATGGAGGCCGCCAGCTTCTACATCGGCTTCTGCTTCTACAAGGTCTGA
Gene >Hirsu2|6549
ATGAGCGCCCGCGGCGGGCGCGGCGGCCGGGGCGGCGGCGGCCCCGGCCGAGGCCGGCCGCCGCCGCGCCTGTTC
GACGCGCGCTTCCACGTCAAGGACTGCTACGGCGAGTCGATCGAGGACGTCGAGATCGTTCGGCAGGTCGGCTTC
GACCCGTCGCCCCTGAACCGCCGCGGCTTCGACGTCGTCAGCCTGCTGTTCTCCATGCACTACGCCTTCGAGTCC
GAGGCCCGTGCCCGCACCATGCTGCGCAACGTGGCCGGCGCCCTCAAAAAGGGCGGCCGCTTCATCGGCTGCATC
CCCAACTCGGACGTCCTCGGCGAGCGCGTCCGCCAGTTCAACGAGAAGGCGGCGGCGAGGCGCAAGGGCGCCGCC
GCCGCCGCCGCCCCGACAACCGAGGACGGCGCCCAGGACGGCACCGGCGGCAGCGGCGACGGCGACGCAAAACCC
CCCCCTCCCGCCGCCGCCACCACCACCACCCAGGAGGAGGAGCCCGAGGACGGCGAGCTGGAGGAGGGCGAGGCG
GAGCCGACGGCGGAGTGGGGCAACTCGATCTACCGCGTGCGCTTCCCCGGCAAGACGCCCGAGGACGGCGTCTTC
CGGCCGGCCTTTGGCTGGAAGTACAGCTTCTTCCTTGACGAGGCCGTCGAGGAGGTGCCCGAGTATGTCGTTCCC
TGGGAGGCCTTCCGCGCCCTGGCCGAGGACTTCAACCTCGAGCTGCAGTTCCACCGCACCTTCCCCGAGATCTGG
GAGGCCGAGAAGGACGACGCCGAGCTCGGCCCGCTCAGCGAGCGCATGGGCGTCCGCGAGCGCGGCGGCGCCGGC
CGCCTGCTCGTCACCGACGAGGAGATGGAGGCCGCCAGCTTCTACATCGGCTTCTGCTTCTACAAGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail