Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6543
Gene name
LocationContig_339:6270..9132
Strand-
Gene length (bp)2862
Transcript length (bp)2397
Coding sequence length (bp)2397
Protein length (aa) 799

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 6.8E-184 99 754

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 39 795 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 78 793 0.0E+00
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 3 793 1.0E-176
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 78 768 1.0E-168
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 70 770 2.0E-165
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 39 795 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 78 793 0.0E+00
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 3 793 1.0E-176
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 78 768 1.0E-168
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 70 770 2.0E-165
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 51 767 8.0E-165
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 77 770 1.0E-162
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 39 768 2.0E-158
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 77 786 5.0E-158
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 56 768 5.0E-157
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 72 770 1.0E-153
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 64 786 8.0E-145
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 2 769 6.0E-132
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 30 776 5.0E-123
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 175 197 22
2 207 229 22
3 234 256 22
4 271 290 19
5 297 314 17
6 324 346 22
7 353 375 22
8 424 446 22
9 478 500 22
10 505 527 22
11 534 556 22
12 588 610 22
13 630 649 19
14 659 676 17
15 683 700 17
16 704 721 17
17 734 756 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6543
MKSSMFRKRHEAEEITPIPAPLESNASGVDHLQHLQQFEKAHKLDPNLPIDELNDVDAAIATGNAEKGIEIEHAL
MEDNSPYPEVRAVVRNYDVDVPVNTVRAWVIGMILCTLGSGINMLFSLRNPNVAITTYVVQLIAYPIGRGWDLIM
PDRVWNLFGLKFNLRPGKFNYKEHVIIVAMSNAAYGGGVLYATDVLIAQKIFYGQDFGPAFQILFGITTLCTGYG
LAGLARRFLVWPAAMIWPADLVNCALFYTLHDHSTSDPSKTNGWSIGRYKLFLIIGGGAFFYYWFPGWIFKGLSV
FAWVCWIAPNSVVVNKIFGAQHGYGLMPVTFDWSIVSGFIGSPLIPPFHAIANVLGGIIFFFVFVSMGVHFSGVW
YSDYVPVQSSESYDNTGKMYNVSRILDANYQFNETAYKEYSPLYLSTQFAMAYGLSFAAMSAVIIHVALYHGKEI
WRQFRMARHQEDDVHMRLMKKYRDAEDWWYAALFIVMIAISFGVVAGWPTGFPAWAFVVCLLLPIIWLIPIGLIQ
AITNIQLGLNVLTEFIIGYMVPGRPLAMMMFKNYGYISMSQALYFSQDLKLGHYMKVPPRVMFASQLVASIWSAI
IQIGVLNWAVNNIPDVCSLGQPNNYTCPNGRVFYTASVVWGAIGPARIFSHGATYASLQWFWLVGAATPIITWLL
ARRWPKSVWRYVCTPVIYGGTGLLPPATVYIFLCWGVVGIIFNYFIKRRYTGWWLQYNYVTSAALDCGLIVSTIV
IFFTLYLTSTDPPNWWGNTGAFRTLDFSNSAISKQVAPGETFGPSVFP*
Coding >Hirsu2|6543
ATGAAGTCGTCCATGTTTCGCAAGCGCCATGAGGCCGAGGAAATCACGCCCATCCCGGCGCCCCTCGAGTCGAAT
GCCTCCGGCGTCGACCACCTGCAGCACCTGCAGCAGTTTGAGAAGGCTCACAAGCTCGACCCAAACCTGCCCATC
GACGAGCTCAACGACGTCGACGCCGCCATCGCCACTGGCAACGCCGAAAAGGGCATCGAGATTGAGCATGCGCTC
ATGGAGGACAACAGCCCTTACCCCGAAGTCCGCGCCGTGGTGCGCAACTACGACGTGGACGTTCCCGTCAACACC
GTTCGAGCCTGGGTCATCGGCATGATTCTCTGCACTCTCGGCTCCGGCATCAACATGCTCTTCTCGCTCCGCAAC
CCCAACGTGGCTATCACTACCTACGTCGTCCAGCTCATTGCCTATCCCATCGGCCGAGGCTGGGATCTCATCATG
CCCGACAGGGTGTGGAATCTGTTCGGGCTCAAGTTCAATCTCAGGCCCGGCAAGTTCAACTACAAGGAGCATGTC
ATCATCGTGGCCATGTCCAATGCTGCGTACGGTGGAGGCGTTCTTTACGCCACAGACGTCTTGATCGCGCAAAAG
ATCTTTTACGGTCAGGACTTCGGTCCTGCCTTTCAGATCCTCTTTGGAATCACCACCCTTTGCACGGGCTACGGC
CTTGCTGGCCTGGCTCGCCGCTTCTTGGTCTGGCCGGCAGCTATGATTTGGCCTGCCGATCTCGTCAACTGCGCC
CTCTTCTACACCCTGCATGACCACTCGACGTCGGACCCCTCCAAGACGAATGGTTGGTCCATTGGACGCTACAAG
CTCTTCCTCATCATCGGCGGTGGCGCCTTCTTCTACTACTGGTTCCCGGGCTGGATCTTCAAGGGCCTCTCCGTC
TTCGCCTGGGTCTGCTGGATCGCGCCCAACAGTGTTGTCGTCAATAAGATCTTTGGCGCCCAGCACGGCTACGGC
TTGATGCCCGTTACCTTCGACTGGTCCATCGTCAGCGGCTTCATTGGGTCGCCCCTCATCCCGCCTTTCCACGCT
ATTGCCAACGTTCTCGGCGGCATCATCTTCTTCTTCGTCTTCGTCTCCATGGGCGTCCACTTCAGCGGTGTGTGG
TATTCCGACTATGTGCCCGTCCAGTCCTCTGAGTCCTACGACAACACGGGCAAGATGTACAATGTCAGCCGCATT
CTCGACGCCAACTACCAGTTCAACGAGACGGCCTACAAAGAGTATTCGCCCCTCTACCTGTCGACCCAGTTCGCC
ATGGCCTACGGCCTATCGTTCGCGGCCATGTCCGCCGTCATCATCCACGTCGCCCTCTACCACGGCAAAGAGATC
TGGAGGCAGTTCAGGATGGCTCGACACCAGGAAGACGACGTCCACATGCGTCTCATGAAGAAGTATCGCGACGCC
GAGGACTGGTGGTACGCCGCGCTGTTCATCGTTATGATTGCCATCTCGTTCGGTGTCGTGGCTGGTTGGCCGACT
GGCTTCCCCGCTTGGGCCTTCGTCGTGTGTCTGCTGCTGCCCATCATCTGGCTAATCCCCATTGGCCTCATCCAA
GCCATCACGAACATCCAGCTCGGCCTCAACGTCCTAACCGAGTTCATCATCGGCTACATGGTGCCCGGACGCCCT
CTGGCCATGATGATGTTCAAGAACTACGGCTACATCTCCATGTCGCAGGCGCTGTACTTCTCACAGGATCTCAAG
CTCGGCCACTATATGAAGGTGCCTCCCCGCGTCATGTTCGCCTCGCAGCTCGTTGCCTCGATATGGTCGGCCATC
ATTCAGATTGGCGTTCTCAACTGGGCCGTCAACAACATCCCCGACGTCTGCAGTCTCGGCCAGCCCAACAACTAC
ACGTGCCCCAACGGTCGCGTCTTCTACACGGCCTCGGTCGTCTGGGGAGCCATCGGCCCGGCCCGCATCTTCAGC
CACGGGGCGACGTACGCCTCGCTGCAGTGGTTCTGGCTCGTCGGCGCCGCCACGCCCATCATCACCTGGCTGCTG
GCGCGCCGGTGGCCCAAGTCTGTGTGGCGCTACGTCTGCACGCCCGTCATCTATGGGGGCACGGGCCTGCTGCCG
CCGGCGACGGTGTACATCTTCCTCTGCTGGGGAGTGGTGGGGATCATCTTCAACTATTTCATCAAGCGTCGGTAC
ACGGGCTGGTGGCTCCAGTACAACTACGTCACCTCTGCCGCCCTGGACTGTGGCCTCATCGTGTCGACCATTGTC
ATCTTCTTCACTTTGTACCTGACGAGCACAGACCCCCCGAACTGGTGGGGGAACACGGGCGCCTTCCGGACCCTG
GACTTTTCCAACTCGGCCATCTCGAAGCAGGTTGCGCCCGGAGAGACGTTTGGGCCGTCGGTCTTCCCCTAG
Transcript >Hirsu2|6543
ATGAAGTCGTCCATGTTTCGCAAGCGCCATGAGGCCGAGGAAATCACGCCCATCCCGGCGCCCCTCGAGTCGAAT
GCCTCCGGCGTCGACCACCTGCAGCACCTGCAGCAGTTTGAGAAGGCTCACAAGCTCGACCCAAACCTGCCCATC
GACGAGCTCAACGACGTCGACGCCGCCATCGCCACTGGCAACGCCGAAAAGGGCATCGAGATTGAGCATGCGCTC
ATGGAGGACAACAGCCCTTACCCCGAAGTCCGCGCCGTGGTGCGCAACTACGACGTGGACGTTCCCGTCAACACC
GTTCGAGCCTGGGTCATCGGCATGATTCTCTGCACTCTCGGCTCCGGCATCAACATGCTCTTCTCGCTCCGCAAC
CCCAACGTGGCTATCACTACCTACGTCGTCCAGCTCATTGCCTATCCCATCGGCCGAGGCTGGGATCTCATCATG
CCCGACAGGGTGTGGAATCTGTTCGGGCTCAAGTTCAATCTCAGGCCCGGCAAGTTCAACTACAAGGAGCATGTC
ATCATCGTGGCCATGTCCAATGCTGCGTACGGTGGAGGCGTTCTTTACGCCACAGACGTCTTGATCGCGCAAAAG
ATCTTTTACGGTCAGGACTTCGGTCCTGCCTTTCAGATCCTCTTTGGAATCACCACCCTTTGCACGGGCTACGGC
CTTGCTGGCCTGGCTCGCCGCTTCTTGGTCTGGCCGGCAGCTATGATTTGGCCTGCCGATCTCGTCAACTGCGCC
CTCTTCTACACCCTGCATGACCACTCGACGTCGGACCCCTCCAAGACGAATGGTTGGTCCATTGGACGCTACAAG
CTCTTCCTCATCATCGGCGGTGGCGCCTTCTTCTACTACTGGTTCCCGGGCTGGATCTTCAAGGGCCTCTCCGTC
TTCGCCTGGGTCTGCTGGATCGCGCCCAACAGTGTTGTCGTCAATAAGATCTTTGGCGCCCAGCACGGCTACGGC
TTGATGCCCGTTACCTTCGACTGGTCCATCGTCAGCGGCTTCATTGGGTCGCCCCTCATCCCGCCTTTCCACGCT
ATTGCCAACGTTCTCGGCGGCATCATCTTCTTCTTCGTCTTCGTCTCCATGGGCGTCCACTTCAGCGGTGTGTGG
TATTCCGACTATGTGCCCGTCCAGTCCTCTGAGTCCTACGACAACACGGGCAAGATGTACAATGTCAGCCGCATT
CTCGACGCCAACTACCAGTTCAACGAGACGGCCTACAAAGAGTATTCGCCCCTCTACCTGTCGACCCAGTTCGCC
ATGGCCTACGGCCTATCGTTCGCGGCCATGTCCGCCGTCATCATCCACGTCGCCCTCTACCACGGCAAAGAGATC
TGGAGGCAGTTCAGGATGGCTCGACACCAGGAAGACGACGTCCACATGCGTCTCATGAAGAAGTATCGCGACGCC
GAGGACTGGTGGTACGCCGCGCTGTTCATCGTTATGATTGCCATCTCGTTCGGTGTCGTGGCTGGTTGGCCGACT
GGCTTCCCCGCTTGGGCCTTCGTCGTGTGTCTGCTGCTGCCCATCATCTGGCTAATCCCCATTGGCCTCATCCAA
GCCATCACGAACATCCAGCTCGGCCTCAACGTCCTAACCGAGTTCATCATCGGCTACATGGTGCCCGGACGCCCT
CTGGCCATGATGATGTTCAAGAACTACGGCTACATCTCCATGTCGCAGGCGCTGTACTTCTCACAGGATCTCAAG
CTCGGCCACTATATGAAGGTGCCTCCCCGCGTCATGTTCGCCTCGCAGCTCGTTGCCTCGATATGGTCGGCCATC
ATTCAGATTGGCGTTCTCAACTGGGCCGTCAACAACATCCCCGACGTCTGCAGTCTCGGCCAGCCCAACAACTAC
ACGTGCCCCAACGGTCGCGTCTTCTACACGGCCTCGGTCGTCTGGGGAGCCATCGGCCCGGCCCGCATCTTCAGC
CACGGGGCGACGTACGCCTCGCTGCAGTGGTTCTGGCTCGTCGGCGCCGCCACGCCCATCATCACCTGGCTGCTG
GCGCGCCGGTGGCCCAAGTCTGTGTGGCGCTACGTCTGCACGCCCGTCATCTATGGGGGCACGGGCCTGCTGCCG
CCGGCGACGGTGTACATCTTCCTCTGCTGGGGAGTGGTGGGGATCATCTTCAACTATTTCATCAAGCGTCGGTAC
ACGGGCTGGTGGCTCCAGTACAACTACGTCACCTCTGCCGCCCTGGACTGTGGCCTCATCGTGTCGACCATTGTC
ATCTTCTTCACTTTGTACCTGACGAGCACAGACCCCCCGAACTGGTGGGGGAACACGGGCGCCTTCCGGACCCTG
GACTTTTCCAACTCGGCCATCTCGAAGCAGGTTGCGCCCGGAGAGACGTTTGGGCCGTCGGTCTTCCCCTAG
Gene >Hirsu2|6543
ATGAAGTCGTCCATGTTTCGCAAGCGCCATGAGGCCGAGGAAATCACGCCCATCCCGGCGCCCCTCGAGTCGAAT
GCCTCCGGCGTCGACCACCTGCAGCACCTGCAGCAGTTTGAGAAGGCTCACAAGCTCGACCCAAACCTGCCCATC
GACGAGCTCAACGACGTCGACGCCGCCATCGCCACTGGCAACGCCGAAAAGGGCATCGAGATTGAGCATGCGCTC
ATGGAGGACAACAGCCCTTACCCCGAAGTACGCCTCCCACCTGTCCCCTTCACGCTTCGTCCGCGCGACTTGTCC
CTGTCGACTCTTCTCCAGTCTTTCACCACTACCATCATTTCTGCTCCCGCTGCGCCGACGTTCATCCATCTATGC
GTCTTCCGCGCCATCGTCATTCGTTGCTTCTGCACTGCCGTTCGTCCTGTCTGACAGTCTCTCCAGGTCCGCGCC
GTGGTGCGCAACTACGACGTGGACGTTCCCGTCAACACCGTTCGAGCCTGGGTCATCGGCATGATTCTCTGCACT
CTCGGCTCCGGCATCAACATGCTCTTCTCGCTCCGCAACCCCAACGTGGCTATCACTACCTACGTCGTCCAGCTC
ATTGCCTATCCCATCGGCCGAGGCTGGGATCTCATCATGCCCGACAGGGTGTGGAATCTGTTCGGGCTCAAGTTC
AATCTCAGGCCCGGCAAGTTCAACTACAAGGAGCATGTCATCATCGTGGCCATGTCCAATGTGAGCAAATTGCCC
CCCCCCCATGGAAAAACAAACCCCCCCTCCCCCCTCCAAACCCCACGAAGAGGTTTTGCCTCGAACTGCGCCTTG
GCAGCCATGGGCCGAGCCGAGTTGTCGTTCCGTCGCCCCACACAGTTGCTGATCCAGCTGGAACTGTTCCTAGGC
TGCGTACGGTGGAGGCGTTCTTTACGCCACAGACGTCTTGATCGCGCAAAAGATCTTTTACGGTCAGGACTTCGG
TCCTGCCTTTCAGATCCTCTTTGGAATCACCACCCTTTGCACGGGCTACGGCCTTGCTGGCCTGGCTCGCCGCTT
CTTGGTCTGGCCGGCAGCTATGATTTGGCCTGCCGATCTCGTCAACTGCGCCCTCTTCTACACCCTGCATGACCA
CTCGACGTCGGACCCCTCCAAGACGAATGGTTGGTCCATTGGACGCTACAAGCTCTTCCTCATCATCGGCGGTGG
CGCCTTCTTCTACTACTGGTTCCCGGGCTGGATCTTCAAGGGCCTCTCCGTCTTCGCCTGGGTCTGCTGGATCGC
GCCCAACAGTGTTGTCGTCAATAAGATCTTTGGCGCCCAGCACGGCTACGGCTTGATGCCCGTTACCTTCGACTG
GTCCATCGTCAGCGGCTTCATTGGGTCGCCCCTCATCCCGCCTTTCCACGCTATTGCCAACGTTCTCGGCGGCAT
CATCTTCTTCTTCGTCTTCGTCTCCATGGGCGTCCACTTCAGCGGTGTGTGGTATTCCGACTATGTGCCCGTCCA
GTCCTCTGAGTCCTACGACAACACGGGCAAGATGTACAATGTCAGCCGCATTCTCGACGCCAACTACCAGTTCAA
CGAGACGGCCTACAAAGAGTATTCGCCCCTCTACCTGTCGACCCAGTTCGCCATGGCCTACGGCCTATCGTTCGC
GGCCATGTCCGCCGTCATCATCCACGTCGCCCTCTACCACGGCAAAGAGATCTGGAGGCAGTTCAGGATGGCTCG
ACACCAGGAAGACGACGTCCACATGCGTCTCATGAAGAAGTATCGCGACGCCGAGGACTGGTGGTACGCCGGTAC
GTGTGCTTCCCCGTCAGTTGCTGCGCCAACGCTCTACCGAACCCCTTGTGGCACACATCGAGAGTCCAAGCTCCC
CTGTCCCACAGGATATGCTGACAGTAGTCCATAGCGCTGTTCATCGTTATGATTGCCATCTCGTTCGGTGTCGTG
GCTGGTTGGCCGACTGGCTTCCCCGCTTGGGCCTTCGTCGTGTGTCTGCTGCTGCCCATCATCTGGCTAATCCCC
ATTGGCCTCATCCAAGCCATCACGAACATCCAGCTCGGCCTCAACGTCCTAACCGAGTTCATCATCGGCTACATG
GTGCCCGGACGCCCTCTGGCCATGATGATGTTCAAGAACTACGGCTACATCTCCATGTCGCAGGCGCTGTACTTC
TCACAGGATCTCAAGCTCGGCCACTATATGAAGGTGCCTCCCCGCGTCATGTTCGCCTCGCAGCTCGTTGCCTCG
ATATGGTCGGCCATCATTCAGATTGGCGTTCTCAACTGGGCCGTCAACAACATCCCCGACGTCTGCAGTCTCGGC
CAGCCCAACAACTACACGTGCCCCAACGGTCGCGTCTTCTACACGGCCTCGGTCGTCTGGGGAGCCATCGGCCCG
GCCCGCATCTTCAGCCACGGGGCGACGTACGCCTCGCTGCAGTGGTTCTGGCTCGTCGGCGCCGCCACGCCCATC
ATCACCTGGCTGCTGGCGCGCCGGTGGCCCAAGTCTGTGTGGCGCTACGTCTGCACGCCCGTCATCTATGGGGGC
ACGGGCCTGCTGCCGCCGGCGACGGTGTACATCTTCCTCTGCTGGGGAGTGGTGGGGATCATCTTCAACTATTTC
ATCAAGCGTCGGTACACGGGCTGGTGGCTCCAGTACAACTACGTCACCTCTGCCGCCCTGGACTGTGGCCTCATC
GTGTCGACCATTGTCATCTTCTTCACTTTGTACCTGACGAGCACAGACCCCCCGAACTGGTGGGGGAACACGGGC
GCCTTCCGGACCCTGGACTTTTCCAACTCGGCCATCTCGAAGCAGGTTGCGCCCGGAGAGACGTTTGGGCCGTCG
GTCTTCCCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail