Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6535
Gene name
LocationContig_338:17587..18418
Strand+
Gene length (bp)831
Transcript length (bp)831
Coding sequence length (bp)831
Protein length (aa) 277

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.3E-13 128 237
PF07714 Pkinase_Tyr Protein tyrosine kinase 6.6E-06 130 229

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94537|PPK4_SCHPO Serine/threonine-protein kinase ppk4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk4 PE=3 SV=1 145 247 7.0E-11
sp|Q9Z2E3|ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus GN=Ern2 PE=2 SV=2 145 246 3.0E-09
sp|Q54MY9|MKCA_DICDI Probable serine/threonine-protein kinase mkcA OS=Dictyostelium discoideum GN=mkcA PE=2 SV=1 145 246 1.0E-08
sp|Q76MJ5|ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens GN=ERN2 PE=1 SV=4 145 246 2.0E-08
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 130 246 5.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94537|PPK4_SCHPO Serine/threonine-protein kinase ppk4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk4 PE=3 SV=1 145 247 7.0E-11
sp|Q9Z2E3|ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus GN=Ern2 PE=2 SV=2 145 246 3.0E-09
sp|Q54MY9|MKCA_DICDI Probable serine/threonine-protein kinase mkcA OS=Dictyostelium discoideum GN=mkcA PE=2 SV=1 145 246 1.0E-08
sp|Q76MJ5|ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens GN=ERN2 PE=1 SV=4 145 246 2.0E-08
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 130 246 5.0E-08
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 130 246 8.0E-08
sp|Q9EQY0|ERN1_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Mus musculus GN=Ern1 PE=1 SV=1 145 246 9.0E-08
sp|O75460|ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 145 246 1.0E-07
sp|P0CD62|LIMKB_DICDI Probable LIM domain-containing serine/threonine-protein kinase DDB_G0286997 OS=Dictyostelium discoideum GN=DDB_G0286997 PE=3 SV=1 133 230 1.0E-07
sp|Q54L00|LIMKA_DICDI Probable LIM domain-containing serine/threonine-protein kinase DDB_G0287001 OS=Dictyostelium discoideum GN=DDB_G0287001 PE=3 SV=1 133 230 2.0E-07
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 127 229 5.0E-07
sp|Q9H422|HIPK3_HUMAN Homeodomain-interacting protein kinase 3 OS=Homo sapiens GN=HIPK3 PE=1 SV=1 147 240 8.0E-07
sp|O35280|CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=1 SV=2 127 229 2.0E-06
sp|B1WBU5|SBK2_RAT Serine/threonine-protein kinase SBK2 OS=Rattus norvegicus GN=Sbk2 PE=2 SV=1 140 244 2.0E-06
sp|Q91ZN7|CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1 127 229 4.0E-06
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 130 246 5.0E-06
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 130 246 5.0E-06
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 127 229 6.0E-06
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 130 246 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6535
MTLPIHQEASQRGSDRPLPRVKSFGDLAGLWESYTVDLTKLLSVSFAVINDDEEVFYGIYPSKSKHDLTIEDCNA
ALRHIADDELYPEVPSGVNLTLAPDELDDRSAFVKRPGLHSLESVEGTGFIPRQILDETLIMETISKSPHPNFIR
YYGCRVKRGRITSLLLERLECTLSEYVTKPEFQQLDRNKFCDELESAVEHLHGLGLAHNDISPLNIMVAEGRAKL
IDFGSCAPYGKTLQSLGSPGWREENFSTSEKKHDEYSLRKIREWIQDPQDP*
Coding >Hirsu2|6535
ATGACGCTCCCGATCCATCAAGAGGCCAGCCAGCGCGGCAGCGACAGACCATTGCCGCGAGTGAAATCTTTTGGA
GACTTGGCAGGCCTTTGGGAATCATACACGGTTGACTTAACGAAACTCCTGTCCGTCAGTTTCGCCGTGATCAAC
GATGATGAGGAGGTCTTCTATGGCATCTATCCATCAAAAAGCAAACATGACTTGACGATCGAGGATTGCAATGCA
GCACTACGACACATTGCCGACGACGAACTTTACCCCGAAGTTCCCTCGGGCGTGAATTTGACTCTCGCTCCAGAC
GAGCTGGACGACAGATCGGCATTTGTGAAGCGCCCGGGTCTTCATTCATTGGAATCAGTGGAGGGCACGGGCTTT
ATACCTCGACAGATTCTCGACGAGACGCTCATCATGGAGACCATTTCTAAGTCTCCCCATCCGAATTTCATCCGT
TATTACGGCTGTCGCGTGAAAAGGGGGCGAATTACGAGCCTACTTCTGGAGCGTCTCGAGTGTACCCTGTCCGAA
TACGTCACTAAGCCCGAGTTCCAACAGCTAGACAGGAACAAGTTCTGCGATGAGTTAGAATCGGCAGTCGAGCAT
CTACACGGGCTAGGCCTAGCGCACAACGATATCAGTCCATTAAATATTATGGTCGCTGAGGGTAGGGCGAAGCTG
ATAGACTTTGGCTCTTGCGCGCCGTATGGCAAGACGCTACAGTCCTTGGGGTCCCCAGGGTGGCGCGAAGAGAAT
TTCTCTACTTCTGAGAAAAAACATGATGAATACTCTCTGAGGAAGATAAGGGAATGGATCCAAGATCCTCAGGAT
CCGTAA
Transcript >Hirsu2|6535
ATGACGCTCCCGATCCATCAAGAGGCCAGCCAGCGCGGCAGCGACAGACCATTGCCGCGAGTGAAATCTTTTGGA
GACTTGGCAGGCCTTTGGGAATCATACACGGTTGACTTAACGAAACTCCTGTCCGTCAGTTTCGCCGTGATCAAC
GATGATGAGGAGGTCTTCTATGGCATCTATCCATCAAAAAGCAAACATGACTTGACGATCGAGGATTGCAATGCA
GCACTACGACACATTGCCGACGACGAACTTTACCCCGAAGTTCCCTCGGGCGTGAATTTGACTCTCGCTCCAGAC
GAGCTGGACGACAGATCGGCATTTGTGAAGCGCCCGGGTCTTCATTCATTGGAATCAGTGGAGGGCACGGGCTTT
ATACCTCGACAGATTCTCGACGAGACGCTCATCATGGAGACCATTTCTAAGTCTCCCCATCCGAATTTCATCCGT
TATTACGGCTGTCGCGTGAAAAGGGGGCGAATTACGAGCCTACTTCTGGAGCGTCTCGAGTGTACCCTGTCCGAA
TACGTCACTAAGCCCGAGTTCCAACAGCTAGACAGGAACAAGTTCTGCGATGAGTTAGAATCGGCAGTCGAGCAT
CTACACGGGCTAGGCCTAGCGCACAACGATATCAGTCCATTAAATATTATGGTCGCTGAGGGTAGGGCGAAGCTG
ATAGACTTTGGCTCTTGCGCGCCGTATGGCAAGACGCTACAGTCCTTGGGGTCCCCAGGGTGGCGCGAAGAGAAT
TTCTCTACTTCTGAGAAAAAACATGATGAATACTCTCTGAGGAAGATAAGGGAATGGATCCAAGATCCTCAGGAT
CCGTAA
Gene >Hirsu2|6535
ATGACGCTCCCGATCCATCAAGAGGCCAGCCAGCGCGGCAGCGACAGACCATTGCCGCGAGTGAAATCTTTTGGA
GACTTGGCAGGCCTTTGGGAATCATACACGGTTGACTTAACGAAACTCCTGTCCGTCAGTTTCGCCGTGATCAAC
GATGATGAGGAGGTCTTCTATGGCATCTATCCATCAAAAAGCAAACATGACTTGACGATCGAGGATTGCAATGCA
GCACTACGACACATTGCCGACGACGAACTTTACCCCGAAGTTCCCTCGGGCGTGAATTTGACTCTCGCTCCAGAC
GAGCTGGACGACAGATCGGCATTTGTGAAGCGCCCGGGTCTTCATTCATTGGAATCAGTGGAGGGCACGGGCTTT
ATACCTCGACAGATTCTCGACGAGACGCTCATCATGGAGACCATTTCTAAGTCTCCCCATCCGAATTTCATCCGT
TATTACGGCTGTCGCGTGAAAAGGGGGCGAATTACGAGCCTACTTCTGGAGCGTCTCGAGTGTACCCTGTCCGAA
TACGTCACTAAGCCCGAGTTCCAACAGCTAGACAGGAACAAGTTCTGCGATGAGTTAGAATCGGCAGTCGAGCAT
CTACACGGGCTAGGCCTAGCGCACAACGATATCAGTCCATTAAATATTATGGTCGCTGAGGGTAGGGCGAAGCTG
ATAGACTTTGGCTCTTGCGCGCCGTATGGCAAGACGCTACAGTCCTTGGGGTCCCCAGGGTGGCGCGAAGAGAAT
TTCTCTACTTCTGAGAAAAAACATGATGAATACTCTCTGAGGAAGATAAGGGAATGGATCCAAGATCCTCAGGAT
CCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail