Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6532
Gene name
LocationContig_338:6721..7689
Strand+
Gene length (bp)968
Transcript length (bp)669
Coding sequence length (bp)669
Protein length (aa) 223

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Transmembrane domain 0.2612 0.2038 0.0385 0.3313 0.6044 0.0442 0.8743 0.5571 0.4047 0.0571

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 187 209 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3436
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|426
Ophiocordyceps australis map64 (Brazil) OphauB2|219
Ophiocordyceps camponoti-floridani Ophcf2|04960
Ophiocordyceps camponoti-rufipedis Ophun1|5589
Ophiocordyceps kimflemingae Ophio5|6108
Ophiocordyceps subramaniannii Hirsu2|6532 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6532
MEHPVREISGVITSLTTGSPAEQQNTLRSYFLSDASFTHPFCRVPSFPKGVIPFAHDVDSRSVILQIYRWYRTLS
PHIEITVDSAVFDQRTGQLFVSIHQIFSLWFVPFYKAPLRLVTVLQLRQRVAQDAAGSAGSAGAGSGEGRESAAL
AGPGQERTRYFIASQEDLYAFTDCAQMLFPGLGPGLWYLWQLFSTLLCVLGSLFFLPLYLLMNRNATAKKVQ*
Coding >Hirsu2|6532
ATGGAACACCCAGTCCGGGAAATCAGCGGCGTCATCACGTCCCTCACCACCGGCAGCCCTGCCGAGCAGCAGAAC
ACGCTCCGAAGCTACTTCCTGTCCGATGCCTCCTTCACGCATCCCTTCTGCCGCGTCCCGTCCTTCCCCAAGGGC
GTCATCCCCTTCGCCCACGATGTCGACTCGCGCTCCGTTATCCTGCAAATATACCGCTGGTACCGCACTCTAAGC
CCTCACATCGAGATAACCGTCGACTCGGCCGTCTTCGACCAGCGCACCGGCCAGCTCTTCGTCTCCATCCACCAG
ATCTTCTCCCTCTGGTTCGTCCCCTTCTACAAGGCTCCCCTCCGCCTCGTGACCGTGCTGCAGCTCCGCCAGCGC
GTCGCTCAGGACGCCGCCGGGTCCGCCGGGTCCGCCGGTGCCGGGTCCGGCGAGGGCCGCGAGTCCGCCGCCCTT
GCCGGCCCCGGCCAGGAGCGCACCCGCTACTTCATCGCCAGCCAGGAGGACCTCTACGCCTTCACCGACTGTGCC
CAGATGCTCTTCCCGGGCCTCGGCCCCGGCCTCTGGTACCTCTGGCAGCTCTTCAGCACCCTCCTCTGTGTCCTC
GGCTCCCTGTTCTTCCTGCCCCTCTACCTGCTGATGAACAGGAACGCGACGGCGAAGAAGGTCCAGTGA
Transcript >Hirsu2|6532
ATGGAACACCCAGTCCGGGAAATCAGCGGCGTCATCACGTCCCTCACCACCGGCAGCCCTGCCGAGCAGCAGAAC
ACGCTCCGAAGCTACTTCCTGTCCGATGCCTCCTTCACGCATCCCTTCTGCCGCGTCCCGTCCTTCCCCAAGGGC
GTCATCCCCTTCGCCCACGATGTCGACTCGCGCTCCGTTATCCTGCAAATATACCGCTGGTACCGCACTCTAAGC
CCTCACATCGAGATAACCGTCGACTCGGCCGTCTTCGACCAGCGCACCGGCCAGCTCTTCGTCTCCATCCACCAG
ATCTTCTCCCTCTGGTTCGTCCCCTTCTACAAGGCTCCCCTCCGCCTCGTGACCGTGCTGCAGCTCCGCCAGCGC
GTCGCTCAGGACGCCGCCGGGTCCGCCGGGTCCGCCGGTGCCGGGTCCGGCGAGGGCCGCGAGTCCGCCGCCCTT
GCCGGCCCCGGCCAGGAGCGCACCCGCTACTTCATCGCCAGCCAGGAGGACCTCTACGCCTTCACCGACTGTGCC
CAGATGCTCTTCCCGGGCCTCGGCCCCGGCCTCTGGTACCTCTGGCAGCTCTTCAGCACCCTCCTCTGTGTCCTC
GGCTCCCTGTTCTTCCTGCCCCTCTACCTGCTGATGAACAGGAACGCGACGGCGAAGAAGGTCCAGTGA
Gene >Hirsu2|6532
ATGGAACACCCAGGTAAGTTCTTCGACGAGCCCATCCTTCCCCCCCTCCCCCCCCTCTCTTGCTCCTACACCCTG
CCGTGCTCGTCCAGAAAGCGACGCTGTCCGAAGCTCTGCACGCTCTCTACTGTAGCATCGTCGTCGTCCTCGTCC
GGAGCTCCCGCCCACTTGGCATCGGGAGTCGAGAACCGCCGCGGCTGACGACAGAGAACCAGTCCGGGAAATCAG
CGGCGTCATCACGTCCCTCACCACCGGCAGCCCTGCCGAGCAGCAGAACACGCTCCGAAGCTACTTCCTGTCCGA
TGCCTCCTTCACGCATCCCTTCTGCCGCGTCCCGTCCTTCCCCAAGGGCGTCATCCCCTTCGCCCACGATGTCGA
CTCGCGCTCCGTTATCCTGCAAATATACCGCTGGTACCGCACTCTAAGCCCTCACATCGAGATAACCGTCGACTC
GGCCGGTATGCCTCTCGTCTCCTTGGGCCCCTGATCGTCGTTGTCGTCGTCGTCGTCGCCGTCACAGTCGGCATC
GGCATACTGCTGACCCTCCCCGTCTGCTAGTCTTCGACCAGCGCACCGGCCAGCTCTTCGTCTCCATCCACCAGA
TCTTCTCCCTCTGGTTCGTCCCCTTCTACAAGGCTCCCCTCCGCCTCGTGACCGTGCTGCAGCTCCGCCAGCGCG
TCGCTCAGGACGCCGCCGGGTCCGCCGGGTCCGCCGGTGCCGGGTCCGGCGAGGGCCGCGAGTCCGCCGCCCTTG
CCGGCCCCGGCCAGGAGCGCACCCGCTACTTCATCGCCAGCCAGGAGGACCTCTACGCCTTCACCGACTGTGCCC
AGATGCTCTTCCCGGGCCTCGGCCCCGGCCTCTGGTACCTCTGGCAGCTCTTCAGCACCCTCCTCTGTGTCCTCG
GCTCCCTGTTCTTCCTGCCCCTCTACCTGCTGATGAACAGGAACGCGACGGCGAAGAAGGTCCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail