Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6527
Gene name
LocationContig_3374:39..867
Strand-
Gene length (bp)828
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 2.8E-05 3 36
PF00153 Mito_carr Mitochondrial carrier protein 5.1E-11 97 174
PF00153 Mito_carr Mitochondrial carrier protein 5.2E-19 190 271

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 4 272 8.0E-31
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 4 272 4.0E-30
sp|Q8BW66|S2548_MOUSE Solute carrier family 25 member 48 OS=Mus musculus GN=Slc25a48 PE=1 SV=2 4 269 1.0E-28
sp|O43772|MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens GN=SLC25A20 PE=1 SV=1 7 275 1.0E-27
sp|Q9Z2Z6|MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 7 275 5.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 4 272 8.0E-31
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 4 272 4.0E-30
sp|Q8BW66|S2548_MOUSE Solute carrier family 25 member 48 OS=Mus musculus GN=Slc25a48 PE=1 SV=2 4 269 1.0E-28
sp|O43772|MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens GN=SLC25A20 PE=1 SV=1 7 275 1.0E-27
sp|Q9Z2Z6|MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 7 275 5.0E-27
sp|Q6ZT89|S2548_HUMAN Solute carrier family 25 member 48 OS=Homo sapiens GN=SLC25A48 PE=1 SV=2 4 269 6.0E-27
sp|Q3MHI3|S2548_BOVIN Solute carrier family 25 member 48 OS=Bos taurus GN=SLC25A48 PE=2 SV=1 4 269 6.0E-27
sp|Q8HXY2|MCAT_MACFA Mitochondrial carnitine/acylcarnitine carrier protein OS=Macaca fascicularis GN=SLC25A20 PE=2 SV=1 7 275 8.0E-27
sp|P97521|MCAT_RAT Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus GN=Slc25a20 PE=1 SV=1 7 275 9.0E-27
sp|A4QNX2|S247B_DANRE Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 3 275 2.0E-25
sp|Q9Y619|ORNT1_HUMAN Mitochondrial ornithine transporter 1 OS=Homo sapiens GN=SLC25A15 PE=1 SV=1 4 269 2.0E-25
sp|Q9WVD5|ORNT1_MOUSE Mitochondrial ornithine transporter 1 OS=Mus musculus GN=Slc25a15 PE=1 SV=1 4 269 4.0E-25
sp|Q9CA93|BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 19 275 4.0E-25
sp|Q54FE6|MCFS_DICDI Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 7 275 7.0E-25
sp|Q6DHS9|S2548_DANRE Solute carrier family 25 member 48 OS=Danio rerio GN=slc25a48 PE=2 SV=1 4 269 7.0E-25
sp|Q10248|YD1K_SCHPO Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 2 271 8.0E-25
sp|Q1ECW7|S247A_DANRE Solute carrier family 25 member 47-A OS=Danio rerio GN=slc25a47a PE=2 SV=1 3 269 1.0E-24
sp|Q6IS41|S2547_MOUSE Solute carrier family 25 member 47 OS=Mus musculus GN=Slc25a47 PE=2 SV=2 4 274 3.0E-24
sp|Q9BXI2|ORNT2_HUMAN Mitochondrial ornithine transporter 2 OS=Homo sapiens GN=SLC25A2 PE=1 SV=3 4 269 4.0E-24
sp|Q6Q0C1|S2547_HUMAN Solute carrier family 25 member 47 OS=Homo sapiens GN=SLC25A47 PE=2 SV=1 4 274 1.0E-23
sp|Q6J329|S2547_RAT Solute carrier family 25 member 47 OS=Rattus norvegicus GN=Slc25a47 PE=2 SV=1 4 274 2.0E-23
sp|Q54BM3|MCFG_DICDI Mitochondrial substrate carrier family protein G OS=Dictyostelium discoideum GN=mcfG PE=2 SV=1 4 275 4.0E-23
sp|Q12289|CRC1_YEAST Mitochondrial carnitine carrier OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRC1 PE=1 SV=1 5 269 4.0E-23
sp|Q8BL03|MCATL_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 1 272 2.0E-22
sp|Q5HZE0|MCATL_RAT Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 1 272 2.0E-22
sp|Q08DK7|MCATL_BOVIN Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 1 265 5.0E-22
sp|Q8N8R3|MCATL_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 1 272 7.0E-22
sp|Q93XM7|MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana GN=BOU PE=2 SV=1 4 269 2.0E-21
sp|Q12375|ORT1_YEAST Mitochondrial ornithine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORT1 PE=1 SV=2 8 271 2.0E-21
sp|Q54W11|MCFL_DICDI Mitochondrial substrate carrier family protein L OS=Dictyostelium discoideum GN=mcfL PE=3 SV=1 4 272 1.0E-20
sp|Q84UC7|BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana GN=BAC1 PE=1 SV=1 4 275 1.0E-20
sp|Q55E85|MCFD_DICDI Mitochondrial substrate carrier family protein D OS=Dictyostelium discoideum GN=mcfD PE=3 SV=1 4 269 3.0E-20
sp|Q27257|DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 4 272 4.0E-19
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 5 269 1.0E-18
sp|Q74Z23|S2538_ASHGO Solute carrier family 25 member 38 homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGR383W PE=3 SV=1 3 275 2.0E-17
sp|A3LVX1|TPC1_PICST Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 5 269 2.0E-17
sp|A5DIS9|TPC1_PICGU Mitochondrial thiamine pyrophosphate carrier 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TPC1 PE=3 SV=3 7 272 4.0E-17
sp|P38087|YMC2_YEAST Carrier protein YMC2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC2 PE=1 SV=1 4 275 5.0E-17
sp|Q6BPW0|TPC1_DEBHA Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 7 269 4.0E-16
sp|Q9VQG4|COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 5 269 8.0E-16
sp|Q86HN8|MCFY_DICDI Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 9 272 2.0E-15
sp|Q96DW6|S2538_HUMAN Solute carrier family 25 member 38 OS=Homo sapiens GN=SLC25A38 PE=1 SV=1 5 272 2.0E-15
sp|A4RPU0|S2538_MAGO7 Solute carrier family 25 member 38 homolog OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05623 PE=3 SV=1 4 272 7.0E-15
sp|P32331|YMC1_YEAST Carrier protein YMC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC1 PE=3 SV=2 4 275 7.0E-15
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 5 249 1.0E-14
sp|Q9VA73|CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 2 274 1.0E-14
sp|Q6CQR3|TPC1_KLULA Mitochondrial thiamine pyrophosphate carrier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPC1 PE=3 SV=1 7 272 3.0E-14
sp|Q54RB9|CMC_DICDI Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 5 269 4.0E-14
sp|Q499U1|S2538_RAT Solute carrier family 25 member 38 OS=Rattus norvegicus GN=Slc25a38 PE=2 SV=2 5 272 4.0E-14
sp|B2MVX9|S2538_SHEEP Solute carrier family 25 member 38 OS=Ovis aries GN=SLC25A38 PE=2 SV=1 5 272 5.0E-14
sp|Q0CT66|S2538_ASPTN Solute carrier family 25 member 38 homolog OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_03118 PE=3 SV=1 4 272 5.0E-14
sp|Q9P6N6|S2538_SCHPO Solute carrier family 25 member 38 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.10c PE=3 SV=1 2 269 5.0E-14
sp|Q91XD8|S2538_MOUSE Solute carrier family 25 member 38 OS=Mus musculus GN=Slc25a38 PE=2 SV=1 5 272 1.0E-13
sp|A2Q9F0|S2538_ASPNC Solute carrier family 25 member 38 homolog OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An01g07650 PE=3 SV=1 4 272 1.0E-13
sp|Q4WQC5|S2538_ASPFU Solute carrier family 25 member 38 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G12340 PE=3 SV=1 4 272 1.0E-13
sp|B0Y4J4|S2538_ASPFC Solute carrier family 25 member 38 homolog OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_069300 PE=3 SV=1 4 272 1.0E-13
sp|A5DX39|TPC1_LODEL Mitochondrial thiamine pyrophosphate carrier 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TPC1 PE=3 SV=1 5 272 1.0E-13
sp|A1CWA4|S2538_NEOFI Solute carrier family 25 member 38 homolog OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_103940 PE=3 SV=1 4 272 1.0E-13
sp|Q9DB41|GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 1 272 2.0E-13
sp|Q94AG6|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 5 250 3.0E-13
sp|Q5EAC0|S2538_BOVIN Solute carrier family 25 member 38 OS=Bos taurus GN=SLC25A38 PE=2 SV=2 5 272 3.0E-13
sp|Q1DRJ3|S2538_COCIM Solute carrier family 25 member 38 homolog OS=Coccidioides immitis (strain RS) GN=CIMG_07070 PE=3 SV=1 4 272 3.0E-13
sp|P0CAT2|S238B_DANRE Solute carrier family 25 member 38-B OS=Danio rerio GN=slc25a38b PE=3 SV=2 5 272 3.0E-13
sp|A1CIF6|S2538_ASPCL Solute carrier family 25 member 38 homolog OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_051330 PE=3 SV=1 4 272 5.0E-13
sp|A6RAY2|S2538_AJECN Solute carrier family 25 member 38 homolog OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_06120 PE=3 SV=1 4 272 2.0E-12
sp|Q12482|AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 5 249 2.0E-12
sp|A6RF73|TPC1_AJECN Mitochondrial thiamine pyrophosphate carrier 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TPC1 PE=3 SV=1 7 275 2.0E-12
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 7 275 2.0E-12
sp|Q6DE75|S2538_XENLA Solute carrier family 25 member 38 OS=Xenopus laevis GN=slc25a38 PE=2 SV=1 5 272 3.0E-12
sp|Q54EV4|MCFA_DICDI Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 2 269 3.0E-12
sp|Q9DAM5|TPC_MOUSE Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus GN=Slc25a19 PE=1 SV=1 7 269 4.0E-12
sp|Q96U08|S2538_NEUCR Solute carrier family 25 member 38 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B7F18.090 PE=3 SV=1 4 272 4.0E-12
sp|Q1E7P0|TPC1_COCIM Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 7 275 1.0E-11
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 7 275 1.0E-11
sp|Q9HC21|TPC_HUMAN Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 91 274 2.0E-11
sp|Q5B717|S2538_EMENI Solute carrier family 25 member 38 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN3663 PE=3 SV=2 4 272 2.0E-11
sp|P79110|TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 7 275 2.0E-11
sp|P38921|PET8_YEAST Putative mitochondrial carrier protein PET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET8 PE=1 SV=1 7 250 2.0E-11
sp|Q29RM1|TPC_BOVIN Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 98 268 2.0E-11
sp|Q6DJ08|S2538_XENTR Solute carrier family 25 member 38 OS=Xenopus tropicalis GN=slc25a38 PE=2 SV=1 5 272 3.0E-11
sp|Q5IS35|TPC_MACFA Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 91 274 3.0E-11
sp|Q59Q36|TPC1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPC1 PE=3 SV=1 7 269 5.0E-11
sp|Q08CI8|S238A_DANRE Solute carrier family 25 member 38-A OS=Danio rerio GN=slc25a38a PE=2 SV=2 5 272 5.0E-11
sp|P23500|MRS4_YEAST Mitochondrial RNA-splicing protein MRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS4 PE=1 SV=1 1 269 5.0E-11
sp|Q920G8|MFRN1_MOUSE Mitoferrin-1 OS=Mus musculus GN=Slc25a37 PE=1 SV=1 2 275 6.0E-11
sp|Q55DY8|MFRN_DICDI Mitoferrin OS=Dictyostelium discoideum GN=mcfF PE=3 SV=1 5 275 6.0E-11
sp|Q2UCW8|TPC1_ASPOR Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 7 275 9.0E-11
sp|Q5AVW1|TPC1_EMENI Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 7 275 1.0E-10
sp|Q505J6|GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus GN=Slc25a18 PE=2 SV=2 1 272 1.0E-10
sp|Q2H608|S2538_CHAGB Solute carrier family 25 member 38 homolog OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05907 PE=3 SV=1 4 272 1.0E-10
sp|Q5SVS4|KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 1 271 1.0E-10
sp|B2VSU4|S2538_PYRTR Solute carrier family 25 member 38 homolog OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_00728 PE=3 SV=1 4 272 1.0E-10
sp|Q9FHX2|MFL1_ARATH Protein MITOFERRINLIKE 1, chloroplastic OS=Arabidopsis thaliana GN=MFL1 PE=2 SV=1 101 269 1.0E-10
sp|Q5IS35|TPC_MACFA Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 7 269 2.0E-10
sp|F4HT41|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 21 250 2.0E-10
sp|Q9D8K8|S2539_MOUSE Solute carrier family 25 member 39 OS=Mus musculus GN=Slc25a39 PE=2 SV=1 94 269 2.0E-10
sp|A7TIQ0|S2538_VANPO Solute carrier family 25 member 38 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1043p32 PE=3 SV=1 8 272 2.0E-10
sp|Q9VAY3|MFRN_DROME Mitoferrin OS=Drosophila melanogaster GN=mfrn PE=2 SV=1 7 275 2.0E-10
sp|Q8HXE3|KMCP1_MACFA Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 1 271 2.0E-10
sp|Q66H23|MFRN1_RAT Mitoferrin-1 OS=Rattus norvegicus GN=Slc25a37 PE=2 SV=1 2 275 4.0E-10
sp|Q0CEN9|TPC1_ASPTN Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 7 275 4.0E-10
sp|Q7S2H8|TPC1_NEUCR Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 7 274 4.0E-10
sp|O60029|PET8_ASHGO Putative mitochondrial carrier protein PET8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PET8 PE=3 SV=1 1 250 4.0E-10
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 1 221 5.0E-10
sp|Q54B67|MCFZ_DICDI Mitochondrial substrate carrier family protein Z OS=Dictyostelium discoideum GN=mcfZ PE=2 SV=1 7 275 6.0E-10
sp|P53007|TXTP_HUMAN Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2 7 275 6.0E-10
sp|P32089|TXTP_RAT Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus GN=Slc25a1 PE=1 SV=1 7 275 7.0E-10
sp|Q287T7|MFRN1_DANRE Mitoferrin-1 OS=Danio rerio GN=slc25a37 PE=1 SV=1 1 275 7.0E-10
sp|Q5NVC1|TPC_PONAB Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 91 274 7.0E-10
sp|Q29RM1|TPC_BOVIN Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 7 269 1.0E-09
sp|Q9NYZ2|MFRN1_HUMAN Mitoferrin-1 OS=Homo sapiens GN=SLC25A37 PE=2 SV=2 2 275 1.0E-09
sp|Q9H1K4|GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens GN=SLC25A18 PE=1 SV=1 1 272 1.0E-09
sp|Q21153|CMC1_CAEEL Probable calcium-binding mitochondrial carrier K02F3.2 OS=Caenorhabditis elegans GN=K02F3.2 PE=3 SV=3 5 274 1.0E-09
sp|Q17QI7|S2539_BOVIN Solute carrier family 25 member 39 OS=Bos taurus GN=SLC25A39 PE=2 SV=2 94 269 1.0E-09
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 78 249 1.0E-09
sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 5 274 1.0E-09
sp|Q9HC21|TPC_HUMAN Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 7 269 2.0E-09
sp|Q9BZJ4|S2539_HUMAN Solute carrier family 25 member 39 OS=Homo sapiens GN=SLC25A39 PE=2 SV=2 70 269 2.0E-09
sp|Q55GE2|ODC_DICDI Probable mitochondrial 2-oxodicarboxylate carrier OS=Dictyostelium discoideum GN=mcfT PE=3 SV=1 7 275 2.0E-09
sp|A4RF23|TPC1_MAGO7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 7 275 2.0E-09
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 4 275 2.0E-09
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 4 255 2.0E-09
sp|Q10442|YDE9_SCHPO Uncharacterized mitochondrial carrier C12B10.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.09 PE=3 SV=1 7 250 2.0E-09
sp|Q8HXW2|CMC2_MACFA Calcium-binding mitochondrial carrier protein Aralar2 OS=Macaca fascicularis GN=SLC25A13 PE=2 SV=1 5 274 2.0E-09
sp|Q4X022|TPC1_ASPFU Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 7 275 3.0E-09
sp|Q5RBC8|CMC1_PONAB Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 5 274 3.0E-09
sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 5 274 3.0E-09
sp|Q9UJS0|CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 5 274 3.0E-09
sp|Q5NVC1|TPC_PONAB Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 7 269 4.0E-09
sp|Q4V9P0|SAMC_DANRE S-adenosylmethionine mitochondrial carrier protein OS=Danio rerio GN=slc25a26 PE=2 SV=1 1 214 4.0E-09
sp|O14281|YETC_SCHPO Uncharacterized mitochondrial carrier C8C9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8C9.12c PE=3 SV=1 1 269 5.0E-09
sp|Q2HFL6|TPC1_CHAGB Mitochondrial thiamine pyrophosphate carrier 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TPC1 PE=3 SV=2 7 272 6.0E-09
sp|Q4V8K4|S2539_RAT Solute carrier family 25 member 39 OS=Rattus norvegicus GN=Slc25a39 PE=2 SV=1 94 269 8.0E-09
sp|Q5RFB7|ODC_PONAB Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 2 269 9.0E-09
sp|Q9DAM5|TPC_MOUSE Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus GN=Slc25a19 PE=1 SV=1 89 271 1.0E-08
sp|A6ZV78|TPC1_YEAS7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=TPC1 PE=3 SV=1 7 275 1.0E-08
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 7 275 1.0E-08
sp|P53257|TPC1_YEAST Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPC1 PE=1 SV=1 7 275 1.0E-08
sp|Q54S10|MCFU_DICDI Mitochondrial substrate carrier family protein U OS=Dictyostelium discoideum GN=mcfU PE=3 SV=1 115 275 2.0E-08
sp|Q54DU1|MCFP_DICDI Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 98 269 2.0E-08
sp|Q6GQ22|KMCP1_XENLA Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 1 271 2.0E-08
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 11 271 2.0E-08
sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 5 274 2.0E-08
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 5 269 2.0E-08
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 7 269 2.0E-08
sp|Q6CNY8|S2538_KLULA Solute carrier family 25 member 38 homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0E08911g PE=3 SV=1 8 272 2.0E-08
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 4 275 2.0E-08
sp|Q6DG32|S2536_DANRE Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 100 271 3.0E-08
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 4 275 3.0E-08
sp|Q5XGI1|KMCP1_XENTR Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 1 271 4.0E-08
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 7 269 4.0E-08
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 4 275 4.0E-08
sp|Q6DG32|S2536_DANRE Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 4 275 5.0E-08
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 4 271 6.0E-08
sp|Q4PDL5|S2538_USTMA Solute carrier family 25 member 38 homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10880 PE=3 SV=2 8 270 6.0E-08
sp|Q8JZU2|TXTP_MOUSE Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 7 275 7.0E-08
sp|A1DI57|TPC1_NEOFI Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 7 275 7.0E-08
sp|Q9H936|GHC1_HUMAN Mitochondrial glutamate carrier 1 OS=Homo sapiens GN=SLC25A22 PE=1 SV=1 1 249 8.0E-08
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 90 249 8.0E-08
sp|P38152|TXTP_YEAST Tricarboxylate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTP1 PE=2 SV=3 5 275 1.0E-07
sp|Q01356|ARG13_NEUCR Amino-acid transporter arg-13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-13 PE=2 SV=1 10 269 1.0E-07
sp|O94502|YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 5 270 1.0E-07
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 90 249 1.0E-07
sp|Q5RD81|GHC1_PONAB Mitochondrial glutamate carrier 1 OS=Pongo abelii GN=SLC25A22 PE=2 SV=1 1 249 1.0E-07
sp|Q03028|ODC1_YEAST Mitochondrial 2-oxodicarboxylate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC1 PE=1 SV=1 4 256 1.0E-07
sp|Q76PC3|YQ73_SCHPO Uncharacterized mitochondrial carrier C1442.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1442.03 PE=3 SV=1 7 220 1.0E-07
sp|A6QR09|SAMC_BOVIN S-adenosylmethionine mitochondrial carrier protein OS=Bos taurus GN=SLC25A26 PE=2 SV=1 1 216 1.0E-07
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 98 271 1.0E-07
sp|Q18P97|UCP1_SUNMU Mitochondrial brown fat uncoupling protein 1 OS=Suncus murinus GN=UCP1 PE=2 SV=1 10 271 2.0E-07
sp|Q6C6I3|S2538_YARLI Solute carrier family 25 member 38 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E09284g PE=3 SV=1 4 272 2.0E-07
sp|P38702|LEU5_YEAST Mitochondrial carrier protein LEU5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU5 PE=3 SV=1 100 241 2.0E-07
sp|Q08DK4|GHC1_BOVIN Mitochondrial glutamate carrier 1 OS=Bos taurus GN=SLC25A22 PE=2 SV=1 1 275 2.0E-07
sp|P10566|MRS3_YEAST Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS3 PE=1 SV=4 3 243 2.0E-07
sp|Q5PQM9|KMCP1_RAT Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 1 271 2.0E-07
sp|Q2UU67|S2538_ASPOR Solute carrier family 25 member 38 homolog OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090009000436 PE=3 SV=1 4 272 2.0E-07
sp|B0G143|UCPB_DICDI Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 4 269 3.0E-07
sp|Q75EP3|TPC1_ASHGO Mitochondrial thiamine pyrophosphate carrier 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TPC1 PE=3 SV=1 7 275 3.0E-07
sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 1 271 3.0E-07
sp|Q7T292|MFRN2_DANRE Mitoferrin-2 OS=Danio rerio GN=slc25a28 PE=2 SV=1 2 275 3.0E-07
sp|Q08CI8|S238A_DANRE Solute carrier family 25 member 38-A OS=Danio rerio GN=slc25a38a PE=2 SV=2 99 275 3.0E-07
sp|B0DK57|S2538_LACBS Solute carrier family 25 member 38 homolog OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_191230 PE=3 SV=1 4 275 4.0E-07
sp|Q9W720|UCP2_DANRE Mitochondrial uncoupling protein 2 OS=Danio rerio GN=ucp2 PE=2 SV=1 21 271 4.0E-07
sp|Q9LJX5|BRTL1_ARATH Probable mitochondrial adenine nucleotide transporter BTL1 OS=Arabidopsis thaliana GN=At3g20240 PE=2 SV=1 80 269 4.0E-07
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 90 249 4.0E-07
sp|P55916|UCP3_HUMAN Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 1 271 4.0E-07
sp|P33303|SFC1_YEAST Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFC1 PE=1 SV=2 5 271 4.0E-07
sp|P25874|UCP1_HUMAN Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 1 271 4.0E-07
sp|Q9CR58|KMCP1_MOUSE Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 1 271 7.0E-07
sp|P40556|YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 6 269 7.0E-07
sp|Q6DHS9|S2548_DANRE Solute carrier family 25 member 48 OS=Danio rerio GN=slc25a48 PE=2 SV=1 7 173 7.0E-07
sp|A6RF73|TPC1_AJECN Mitochondrial thiamine pyrophosphate carrier 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TPC1 PE=3 SV=1 90 251 7.0E-07
sp|Q8R0Z5|MFRN2_MOUSE Mitoferrin-2 OS=Mus musculus GN=Slc25a28 PE=2 SV=1 7 275 8.0E-07
sp|Q96A46|MFRN2_HUMAN Mitoferrin-2 OS=Homo sapiens GN=SLC25A28 PE=2 SV=1 7 275 9.0E-07
sp|A7TDX5|TPC1_VANPO Mitochondrial thiamine pyrophosphate carrier 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TPC1 PE=3 SV=1 7 275 9.0E-07
sp|A0PC02|UCP1_OCHDA Mitochondrial brown fat uncoupling protein 1 OS=Ochotona dauurica GN=UCP1 PE=2 SV=1 1 271 1.0E-06
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 7 269 1.0E-06
sp|Q9D6M3|GHC1_MOUSE Mitochondrial glutamate carrier 1 OS=Mus musculus GN=Slc25a22 PE=1 SV=1 1 249 1.0E-06
sp|Q12251|YP011_YEAST Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 86 271 1.0E-06
sp|O13844|YFG5_SCHPO Uncharacterized mitochondrial carrier C19G12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.05 PE=3 SV=1 7 275 1.0E-06
sp|Q5U3V7|S2543_DANRE Solute carrier family 25 member 43 OS=Danio rerio GN=slc25a43 PE=2 SV=1 188 272 2.0E-06
sp|O97562|UCP2_PIG Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 21 271 2.0E-06
sp|O14281|YETC_SCHPO Uncharacterized mitochondrial carrier C8C9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8C9.12c PE=3 SV=1 95 275 2.0E-06
sp|A7F9Y3|S2538_SCLS1 Solute carrier family 25 member 38 homolog OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_14414 PE=3 SV=1 4 272 3.0E-06
sp|Q9SUV1|BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=BT1 PE=1 SV=1 100 271 4.0E-06
sp|Q70HW3|SAMC_HUMAN S-adenosylmethionine mitochondrial carrier protein OS=Homo sapiens GN=SLC25A26 PE=2 SV=1 7 250 4.0E-06
sp|P34519|TXTP_CAEEL Putative tricarboxylate transport protein, mitochondrial OS=Caenorhabditis elegans GN=K11H3.3 PE=3 SV=1 80 275 4.0E-06
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 5 275 4.0E-06
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 7 271 5.0E-06
sp|A2R5A0|TPC1_ASPNC Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 7 275 8.0E-06
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 4 271 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 55 77 22
2 97 119 22
3 134 156 22
4 246 268 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6527
MSAEFWAGYISGAASIILGNPLDLLKVRLQAAQPNVPVKDAGVYLSSAAPRLSTIVTGTAVPILSHGALNAILLV
SYKRFEFALNKAWSTREGNLSAVWLAGAVGGLCTWTVSAPTEIIKCRAQASSPTISSWAIARQIWTTFGLPGLYI
GGSVTALRDCIGYGFYFWSYELANSHWPWPSTTTPRDSSRAVLCGGLAGIVAWASVFPLDVIKTRVQTQVWHPSR
KRIGALRVAIETLKKEGTRAFFQGLTICSIRAFVVNAVHWVIYERILYIL*
Coding >Hirsu2|6527
ATGTCGGCTGAATTCTGGGCTGGCTATATCAGCGGCGCTGCGAGCATCATTCTTGGAAATCCTCTCGATTTACTC
AAAGTTCGATTGCAGGCAGCACAACCAAACGTTCCGGTCAAAGATGCTGGTGTCTATTTATCCTCTGCGGCACCT
CGCCTCTCCACCATAGTGACAGGAACTGCCGTCCCGATTCTCAGTCATGGTGCCTTGAATGCCATACTTCTTGTG
TCGTACAAGCGCTTCGAATTTGCGCTGAACAAGGCTTGGTCAACGCGGGAAGGAAATTTGTCCGCTGTCTGGTTA
GCAGGCGCCGTCGGTGGACTCTGCACTTGGACCGTTAGCGCCCCAACTGAGATCATCAAGTGCCGAGCTCAAGCT
TCATCACCTACCATATCAAGCTGGGCTATTGCCCGACAAATCTGGACAACTTTCGGTCTCCCCGGGCTCTATATC
GGTGGCTCGGTCACCGCATTGCGCGATTGTATCGGCTACGGCTTCTACTTCTGGTCTTACGAGCTGGCCAACAGT
CACTGGCCATGGCCATCGACTACTACGCCGCGTGATTCTTCGCGAGCCGTACTCTGTGGCGGCCTAGCAGGTATC
GTAGCATGGGCTAGTGTTTTCCCTCTCGATGTTATCAAAACACGTGTGCAAACGCAGGTTTGGCACCCATCCCGT
AAGCGCATTGGGGCCCTGCGAGTCGCTATAGAGACTTTAAAGAAGGAAGGGACGCGAGCATTCTTTCAAGGCTTG
ACCATTTGTAGTATAAGGGCTTTTGTTGTTAACGCAGTCCACTGGGTTATTTATGAGCGCATACTATATATACTA
TAG
Transcript >Hirsu2|6527
ATGTCGGCTGAATTCTGGGCTGGCTATATCAGCGGCGCTGCGAGCATCATTCTTGGAAATCCTCTCGATTTACTC
AAAGTTCGATTGCAGGCAGCACAACCAAACGTTCCGGTCAAAGATGCTGGTGTCTATTTATCCTCTGCGGCACCT
CGCCTCTCCACCATAGTGACAGGAACTGCCGTCCCGATTCTCAGTCATGGTGCCTTGAATGCCATACTTCTTGTG
TCGTACAAGCGCTTCGAATTTGCGCTGAACAAGGCTTGGTCAACGCGGGAAGGAAATTTGTCCGCTGTCTGGTTA
GCAGGCGCCGTCGGTGGACTCTGCACTTGGACCGTTAGCGCCCCAACTGAGATCATCAAGTGCCGAGCTCAAGCT
TCATCACCTACCATATCAAGCTGGGCTATTGCCCGACAAATCTGGACAACTTTCGGTCTCCCCGGGCTCTATATC
GGTGGCTCGGTCACCGCATTGCGCGATTGTATCGGCTACGGCTTCTACTTCTGGTCTTACGAGCTGGCCAACAGT
CACTGGCCATGGCCATCGACTACTACGCCGCGTGATTCTTCGCGAGCCGTACTCTGTGGCGGCCTAGCAGGTATC
GTAGCATGGGCTAGTGTTTTCCCTCTCGATGTTATCAAAACACGTGTGCAAACGCAGGTTTGGCACCCATCCCGT
AAGCGCATTGGGGCCCTGCGAGTCGCTATAGAGACTTTAAAGAAGGAAGGGACGCGAGCATTCTTTCAAGGCTTG
ACCATTTGTAGTATAAGGGCTTTTGTTGTTAACGCAGTCCACTGGGTTATTTATGAGCGCATACTATATATACTA
TAG
Gene >Hirsu2|6527
ATGTCGGCTGAATTCTGGGCTGGCTATATCAGCGGCGCTGCGAGCATCATTCTTGGAAATCCTCTCGATTTACTC
AAAGTTCGATTGCAGGCAGCACAACCAAACGTTCCGGTCAAAGATGCTGGTGTCTATTTATCCTCTGCGGCACCT
CGCCTCTCCACCATAGTGACAGGAACTGCCGTCCCGATTCTCAGTCATGGTGCCTTGAATGCCATACTTCTTGTG
TCGTACAAGCGCTTCGAATTTGCGCTGAACAAGGCTTGGTCAACGCGGGAAGGAAATTTGTCCGCTGTCTGGTTA
GCAGGCGCCGTCGGTGGACTCTGCACTTGGACCGTTAGCGCCCCAACTGAGATCATCAAGTGCCGAGCTCAAGCT
TCATCACCTACCATATCAAGCTGGGCTATTGCCCGACAAATCTGGACAACTTTCGGTCTCCCCGGGCTCTATATC
GGTGGCTCGGTCACCGCATTGCGCGATTGTATCGGCTACGGCTTCTACTTCTGGTCTTACGAGCTGGCCAACAGT
CACTGGCCATGGCCATCGACTACTACGCCGCGTGATTCTTCGCGAGCCGTACTCTGTGGCGGCCTAGCAGGTATC
GTAGCATGGGCTAGTGTTTTCCCTCTCGATGTTATCAAAACACGTGTGCAAACGCAGGTTTGGCACCCATCCCGT
AAGCGCATTGGGGCCCTGCGAGTCGCTATAGAGACTTTAAAGAAGGAAGGGACGCGAGCATTCTTTCAAGGCTTG
ACCATTTGTAGTATAAGGGCTTTTGTTGTTAACGCAGTCCACTGGGTTATTTATGAGCGCATACTATATATACTA
TAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail