Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6509
Gene name
LocationContig_3357:28..835
Strand+
Gene length (bp)807
Transcript length (bp)552
Coding sequence length (bp)552
Protein length (aa) 184

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein 5.5E-60 2 182

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I0M9|PTPA1_GIBZE Serine/threonine-protein phosphatase 2A activator 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRD1 PE=3 SV=1 2 182 1.0E-91
sp|Q7S6M5|PTPA1_NEUCR Serine/threonine-protein phosphatase 2A activator 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrd-1 PE=3 SV=1 2 182 1.0E-67
sp|Q4WMU5|PTPA1_ASPFU Serine/threonine-protein phosphatase 2A activator 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrd1 PE=3 SV=2 2 182 8.0E-63
sp|Q5B6C5|PTPA1_EMENI Serine/threonine-protein phosphatase 2A activator 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrd1 PE=3 SV=1 2 182 1.0E-62
sp|Q2UN27|PTPA1_ASPOR Serine/threonine-protein phosphatase 2A activator 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrd1 PE=3 SV=1 2 182 1.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I0M9|PTPA1_GIBZE Serine/threonine-protein phosphatase 2A activator 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRD1 PE=3 SV=1 2 182 1.0E-91
sp|Q7S6M5|PTPA1_NEUCR Serine/threonine-protein phosphatase 2A activator 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrd-1 PE=3 SV=1 2 182 1.0E-67
sp|Q4WMU5|PTPA1_ASPFU Serine/threonine-protein phosphatase 2A activator 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrd1 PE=3 SV=2 2 182 8.0E-63
sp|Q5B6C5|PTPA1_EMENI Serine/threonine-protein phosphatase 2A activator 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrd1 PE=3 SV=1 2 182 1.0E-62
sp|Q2UN27|PTPA1_ASPOR Serine/threonine-protein phosphatase 2A activator 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrd1 PE=3 SV=1 2 182 1.0E-50
sp|Q6CFX5|PTPA1_YARLI Serine/threonine-protein phosphatase 2A activator 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRD1 PE=3 SV=1 7 182 4.0E-42
sp|P40454|PTPA1_YEAST Serine/threonine-protein phosphatase 2A activator 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRD1 PE=1 SV=1 2 141 5.0E-34
sp|Q6FRQ9|PTPA1_CANGA Serine/threonine-protein phosphatase 2A activator 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRD1 PE=3 SV=1 2 182 1.0E-33
sp|Q54WH6|PTPA2_DICDI Probable serine/threonine-protein phosphatase 2A activator 2 OS=Dictyostelium discoideum GN=ppp2r4B PE=3 SV=1 4 142 8.0E-33
sp|O36016|PTPA1_SCHPO Serine/threonine-protein phosphatase 2A activator 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrd1 PE=3 SV=1 2 182 2.0E-32
sp|Q28717|PTPA_RABIT Serine/threonine-protein phosphatase 2A activator OS=Oryctolagus cuniculus GN=PPP2R4 PE=1 SV=1 3 142 2.0E-32
sp|P58389|PTPA_MOUSE Serine/threonine-protein phosphatase 2A activator OS=Mus musculus GN=Ppp2r4 PE=1 SV=1 8 142 5.0E-32
sp|Q15257|PTPA_HUMAN Serine/threonine-protein phosphatase 2A activator OS=Homo sapiens GN=PPP2R4 PE=1 SV=3 3 142 7.0E-32
sp|Q2KJ44|PTPA_BOVIN Serine/threonine-protein phosphatase 2A activator OS=Bos taurus GN=PPP2R4 PE=2 SV=1 3 142 1.0E-31
sp|Q4P4W3|PTPA1_USTMA Serine/threonine-protein phosphatase 2A activator 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRD1 PE=3 SV=1 8 144 2.0E-31
sp|P0C153|PTPA2_EMENI Serine/threonine-protein phosphatase 2A activator 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrd2 PE=3 SV=1 5 143 1.0E-30
sp|Q55CJ3|PTPA1_DICDI Probable serine/threonine-protein phosphatase 2A activator 1 OS=Dictyostelium discoideum GN=ppp2r4A PE=3 SV=1 8 142 2.0E-30
sp|Q6BNW4|PTPA1_DEBHA Serine/threonine-protein phosphatase 2A activator 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRD1 PE=3 SV=2 2 155 2.0E-30
sp|Q6CYH1|PTPA1_KLULA Serine/threonine-protein phosphatase 2A activator 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRD1 PE=3 SV=1 2 182 5.0E-30
sp|Q753L9|PTPA1_ASHGO Serine/threonine-protein phosphatase 2A activator 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRD1 PE=3 SV=1 3 182 9.0E-30
sp|Q6CKF0|PTPA2_KLULA Serine/threonine-protein phosphatase 2A activator 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRD2 PE=3 SV=1 5 175 2.0E-29
sp|Q59ST6|PTPA2_CANAL Serine/threonine-protein phosphatase 2A activator 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRD2 PE=3 SV=1 1 143 4.0E-29
sp|P0CQ00|PTPA1_CRYNJ Serine/threonine-protein phosphatase 2A activator 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRD1 PE=3 SV=1 2 142 6.0E-29
sp|P0CQ01|PTPA1_CRYNB Serine/threonine-protein phosphatase 2A activator 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRD1 PE=3 SV=1 2 142 6.0E-29
sp|Q6C712|PTPA2_YARLI Serine/threonine-protein phosphatase 2A activator 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRD2 PE=3 SV=2 3 142 2.0E-28
sp|Q5ADP9|PTPA1_CANAL Serine/threonine-protein phosphatase 2A activator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRD1 PE=3 SV=1 2 153 2.0E-28
sp|Q6BU97|PTPA2_DEBHA Serine/threonine-protein phosphatase 2A activator 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRD2 PE=3 SV=2 10 145 4.0E-28
sp|Q7SEF9|PTPA2_NEUCR Serine/threonine-protein phosphatase 2A activator 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrd-2 PE=3 SV=1 3 142 6.0E-28
sp|Q75BY1|PTPA2_ASHGO Serine/threonine-protein phosphatase 2A activator 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRD2 PE=3 SV=1 5 142 2.0E-26
sp|P0CQ02|PTPA2_CRYNJ Serine/threonine-protein phosphatase 2A activator 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRD2 PE=3 SV=1 3 142 5.0E-26
sp|P0CQ03|PTPA2_CRYNB Serine/threonine-protein phosphatase 2A activator 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRD2 PE=3 SV=1 3 142 5.0E-26
sp|Q4WSA8|PTPA2_ASPFU Serine/threonine-protein phosphatase 2A activator 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrd2 PE=3 SV=1 5 142 8.0E-26
sp|Q4INW6|PTPA2_GIBZE Serine/threonine-protein phosphatase 2A activator 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRD2 PE=3 SV=2 3 142 1.0E-25
sp|Q6FK00|PTPA2_CANGA Serine/threonine-protein phosphatase 2A activator 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRD2 PE=3 SV=1 5 142 3.0E-25
sp|Q9P7H4|PTPA2_SCHPO Serine/threonine-protein phosphatase 2A activator 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrd2 PE=3 SV=1 10 144 4.0E-25
sp|Q12461|PTPA2_YEAST Serine/threonine-protein phosphatase 2A activator 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRD2 PE=1 SV=1 5 143 8.0E-25
sp|Q4PCR0|PTPA2_USTMA Serine/threonine-protein phosphatase 2A activator 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRD2 PE=3 SV=1 7 143 2.0E-24
sp|Q2UCL6|PTPA2_ASPOR Serine/threonine-protein phosphatase 2A activator 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrd2 PE=3 SV=1 5 143 1.0E-23
sp|Q8SVB5|PTPA_ENCCU Serine/threonine-protein phosphatase 2A activator OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_0720 PE=3 SV=1 2 145 2.0E-22
[Show less]

GO

GO Term Description Terminal node
GO:0019211 phosphatase activator activity Yes
GO:0019208 phosphatase regulator activity No
GO:0003674 molecular_function No
GO:0008047 enzyme activator activity No
GO:0030234 enzyme regulator activity No
GO:0098772 molecular function regulator No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6509
LAPTDPGPRRFGNVSFRRWHALVEEGLPALLARALGAAALDDDEVATYFLGAFGSPQRLDYGTGHELSFLAFLGC
LWKLGFFRDGRQGGDIEREIVLEVIEPYLRVVRKLILTYTLEPAGSHGVWGLDDHSFVPYIFGSAQLTRPIADEA
EPMPLEGSVAGAPAPADIAKPAVVEAQRAANMA*
Coding >Hirsu2|6509
CTGGCCCCGACCGACCCGGGCCCCCGCCGCTTCGGCAACGTCAGCTTCCGCCGCTGGCACGCCCTGGTGGAGGAG
GGCCTGCCGGCGCTGCTGGCCCGCGCGCTGGGCGCCGCCGCGCTCGACGATGACGAGGTCGCCACCTACTTCCTC
GGCGCCTTCGGGAGCCCCCAGCGGCTCGACTACGGCACGGGCCACGAGCTCAGCTTCCTCGCCTTCCTCGGCTGC
CTGTGGAAGCTGGGCTTCTTCCGCGACGGGAGGCAGGGCGGCGACATTGAGCGGGAGATTGTCCTCGAGGTCATC
GAGCCGTATCTGAGGGTCGTGCGCAAGCTGATCCTGACGTACACGCTCGAGCCGGCCGGCTCGCACGGCGTCTGG
GGCCTCGACGACCACTCCTTCGTGCCCTACATCTTCGGCTCGGCGCAGCTGACGCGGCCCATCGCCGACGAGGCC
GAGCCGATGCCGCTCGAAGGCTCCGTCGCGGGCGCGCCCGCGCCGGCCGACATCGCCAAGCCGGCCGTAGTCGAG
GCCCAGCGCGCCGCCAACATGGCATGA
Transcript >Hirsu2|6509
CTGGCCCCGACCGACCCGGGCCCCCGCCGCTTCGGCAACGTCAGCTTCCGCCGCTGGCACGCCCTGGTGGAGGAG
GGCCTGCCGGCGCTGCTGGCCCGCGCGCTGGGCGCCGCCGCGCTCGACGATGACGAGGTCGCCACCTACTTCCTC
GGCGCCTTCGGGAGCCCCCAGCGGCTCGACTACGGCACGGGCCACGAGCTCAGCTTCCTCGCCTTCCTCGGCTGC
CTGTGGAAGCTGGGCTTCTTCCGCGACGGGAGGCAGGGCGGCGACATTGAGCGGGAGATTGTCCTCGAGGTCATC
GAGCCGTATCTGAGGGTCGTGCGCAAGCTGATCCTGACGTACACGCTCGAGCCGGCCGGCTCGCACGGCGTCTGG
GGCCTCGACGACCACTCCTTCGTGCCCTACATCTTCGGCTCGGCGCAGCTGACGCGGCCCATCGCCGACGAGGCC
GAGCCGATGCCGCTCGAAGGCTCCGTCGCGGGCGCGCCCGCGCCGGCCGACATCGCCAAGCCGGCCGTAGTCGAG
GCCCAGCGCGCCGCCAACATGGCATGA
Gene >Hirsu2|6509
CTGGCCCCGACCGACCCGGGCCCCCGCCGCTTCGGCAACGTCAGCTTCCGCCGCTGGCACGCCCTGGTGGAGGAG
GGCCTGCCGGCGCTGCTGGCCCGCGCGCTGGGCGCCGCCGCGCTCGACGATGACGAGGTCGCCACCTACTTCCTC
GGCGCCTTCGGGAGCCCCCAGCGGCTCGACTACGGCACGGGCCACGAGCTCAGCTTCCTCGCCTTCCTCGGCTGC
CTGTGGAAGCTGGGCTTCTTCCGCGACGGGAGGCAGGGCGGCGACATTGAGCGGGAGATTGTCCTCGAGGTCATC
GAGCCGTAAGCCCGCATACCCCCCCAACCAACCAACCACCGTTTTGCCCCAAAATATGAACCCGGAGAACAAGGG
GGAGCTTAGGGTGTCGCGTCCCGGAAGAGAGAGAGGGGGAGGGGCAGGTTCGGTGGCTGACGCGCATCAGGTATC
TGAGGGTCGTGCGCAAGCTGATCCTGACGTACACGCTCGAGCCGGCCGGCTCGCACGGCGTCTGGGGCCTCGACG
ACCACTCCTTCGTGCCCTACATCTTCGGCTCGGCGCAGCTGACGCGGCCCATCGCCGACGAGGCCGAGCCGATGC
CGCTCGAAGGCTCCGTCGCGGGCGCGCCCGCGCCGGCCGACATCGCCAAGCCGGCCGTAGTCGAGGCCCAGCGCG
CCGCCAACATGTACTTTTCCGCCGTCGGCTTCGTCAACGACGTCAAGCGCGGCCCCTTCTGGGAGCACAGCCCGC
TCCTCTTCGACATCTCGGGCATCCGCCACGGCTGGGGCAAGATCAACAAGGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail