Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6508
Gene name
LocationContig_3355:151..792
Strand-
Gene length (bp)641
Transcript length (bp)573
Coding sequence length (bp)573
Protein length (aa) 191

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 1.3E-11 33 135
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 2.7E-08 79 136
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 5.9E-07 45 136
PF08445 FR47 FR47-like protein 1.9E-06 80 136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74457|NAT3_SCHPO N-terminal acetyltransferase B complex catalytic subunit naa20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=naa20 PE=3 SV=1 1 189 2.0E-45
sp|Q8SSN5|NAA20_DICDI N-alpha-acetyltransferase 20 OS=Dictyostelium discoideum GN=nat5 PE=3 SV=2 1 175 3.0E-44
sp|Q58ED9|NAA20_DANRE N-alpha-acetyltransferase 20 OS=Danio rerio GN=naa20 PE=2 SV=1 1 189 7.0E-43
sp|Q7ZXR3|NAA20_XENLA N-alpha-acetyltransferase 20 OS=Xenopus laevis GN=naa20 PE=2 SV=1 1 189 3.0E-42
sp|P61600|NAA20_MOUSE N-alpha-acetyltransferase 20 OS=Mus musculus GN=Naa20 PE=1 SV=1 1 189 4.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74457|NAT3_SCHPO N-terminal acetyltransferase B complex catalytic subunit naa20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=naa20 PE=3 SV=1 1 189 2.0E-45
sp|Q8SSN5|NAA20_DICDI N-alpha-acetyltransferase 20 OS=Dictyostelium discoideum GN=nat5 PE=3 SV=2 1 175 3.0E-44
sp|Q58ED9|NAA20_DANRE N-alpha-acetyltransferase 20 OS=Danio rerio GN=naa20 PE=2 SV=1 1 189 7.0E-43
sp|Q7ZXR3|NAA20_XENLA N-alpha-acetyltransferase 20 OS=Xenopus laevis GN=naa20 PE=2 SV=1 1 189 3.0E-42
sp|P61600|NAA20_MOUSE N-alpha-acetyltransferase 20 OS=Mus musculus GN=Naa20 PE=1 SV=1 1 189 4.0E-42
sp|Q2PFM2|NAA20_MACFA N-alpha-acetyltransferase 20 OS=Macaca fascicularis GN=NAA20 PE=2 SV=1 1 189 4.0E-42
sp|P61599|NAA20_HUMAN N-alpha-acetyltransferase 20 OS=Homo sapiens GN=NAA20 PE=1 SV=1 1 189 4.0E-42
sp|Q6P632|NAA20_XENTR N-alpha-acetyltransferase 20 OS=Xenopus tropicalis GN=naa20 PE=2 SV=1 1 189 2.0E-41
sp|Q06504|NAT3_YEAST N-terminal acetyltransferase B complex catalytic subunit NAT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAT3 PE=1 SV=2 1 189 1.0E-35
sp|Q05885|ARD1_LEIDO N-terminal acetyltransferase complex ARD1 subunit homolog OS=Leishmania donovani GN=ARD1 PE=3 SV=1 1 189 3.0E-31
sp|P41227|NAA10_HUMAN N-alpha-acetyltransferase 10 OS=Homo sapiens GN=NAA10 PE=1 SV=1 3 180 7.0E-22
sp|Q2KI14|NAA10_BOVIN N-alpha-acetyltransferase 10 OS=Bos taurus GN=NAA10 PE=2 SV=1 3 180 7.0E-22
sp|Q9QY36|NAA10_MOUSE N-alpha-acetyltransferase 10 OS=Mus musculus GN=Naa10 PE=1 SV=1 3 171 9.0E-22
sp|Q9BSU3|NAA11_HUMAN N-alpha-acetyltransferase 11 OS=Homo sapiens GN=NAA11 PE=1 SV=3 3 170 1.0E-21
sp|Q3UX61|NAA11_MOUSE N-alpha-acetyltransferase 11 OS=Mus musculus GN=Naa11 PE=1 SV=1 4 180 5.0E-21
sp|Q4V8K3|NAA11_RAT N-alpha-acetyltransferase 11 OS=Rattus norvegicus GN=Naa11 PE=2 SV=1 3 180 2.0E-20
sp|P36416|ARD1_DICDI N-terminal acetyltransferase complex ARD1 subunit homolog OS=Dictyostelium discoideum GN=natA PE=2 SV=1 1 147 2.0E-17
sp|O61219|DAF31_CAEEL N-alpha-acetyltransferase daf-31 OS=Caenorhabditis elegans GN=daf-31 PE=2 SV=1 4 168 8.0E-17
sp|Q9UTI3|ARD1_SCHPO N-terminal acetyltransferase A complex catalytic subunit ard1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ard1 PE=1 SV=1 4 164 2.0E-15
sp|Q976C3|Y258_SULTO Uncharacterized N-acetyltransferase STK_02580 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_02580 PE=3 SV=1 4 147 2.0E-12
sp|P07347|ARD1_YEAST N-terminal acetyltransferase A complex catalytic subunit ARD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARD1 PE=1 SV=2 55 167 6.0E-12
sp|Q980R9|Y209_SULSO Uncharacterized N-acetyltransferase SSO0209 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0209 PE=1 SV=2 3 147 2.0E-11
sp|Q58925|Y1530_METJA Uncharacterized N-acetyltransferase MJ1530 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1530 PE=3 SV=1 4 157 6.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016747 transferase activity, transferring acyl groups other than amino-acyl groups Yes
GO:0016746 transferase activity, transferring acyl groups No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6508
MATFRSFRPDDIHKLSKCNFDILTETYEPGFYLQYYAKWASLFQVCEDVNGNINGYIMGKVESSPDAYNFSEHYL
PWHAHITALTVAPEARRLGIGKILTRQLEAAADANDAWFVDLFVRQSNERAIAFYTDLGYNIFRLVKGYYGDHTT
DIFKISEDALDMRKSMKRDVQRQYVRSNGRDYEVNPEDVW*
Coding >Hirsu2|6508
ATGGCGACATTTCGATCGTTTCGGCCGGACGATATTCATAAATTATCAAAGTGCAATTTCGATATATTAACGGAA
ACATATGAGCCTGGTTTTTATCTCCAATATTATGCGAAATGGGCGTCACTCTTCCAAGTGTGCGAAGACGTTAAT
GGAAACATCAATGGCTACATCATGGGCAAGGTCGAGTCTTCGCCCGATGCCTATAATTTTTCGGAGCATTATCTC
CCGTGGCACGCTCATATTACAGCGTTGACGGTCGCCCCCGAAGCTCGCCGGCTTGGAATTGGTAAAATCTTGACT
AGGCAGCTAGAAGCCGCAGCTGACGCCAATGACGCCTGGTTCGTGGACCTCTTTGTCCGTCAAAGTAACGAAAGG
GCTATCGCATTCTATACGGACCTTGGTTACAATATATTCCGTCTTGTAAAAGGTTATTACGGAGACCACACCACA
GATATATTTAAAATTAGCGAGGATGCTCTTGACATGAGGAAGTCGATGAAGCGGGACGTACAACGGCAATATGTA
AGAAGCAATGGGAGGGATTATGAAGTCAATCCAGAGGATGTTTGGTAG
Transcript >Hirsu2|6508
ATGGCGACATTTCGATCGTTTCGGCCGGACGATATTCATAAATTATCAAAGTGCAATTTCGATATATTAACGGAA
ACATATGAGCCTGGTTTTTATCTCCAATATTATGCGAAATGGGCGTCACTCTTCCAAGTGTGCGAAGACGTTAAT
GGAAACATCAATGGCTACATCATGGGCAAGGTCGAGTCTTCGCCCGATGCCTATAATTTTTCGGAGCATTATCTC
CCGTGGCACGCTCATATTACAGCGTTGACGGTCGCCCCCGAAGCTCGCCGGCTTGGAATTGGTAAAATCTTGACT
AGGCAGCTAGAAGCCGCAGCTGACGCCAATGACGCCTGGTTCGTGGACCTCTTTGTCCGTCAAAGTAACGAAAGG
GCTATCGCATTCTATACGGACCTTGGTTACAATATATTCCGTCTTGTAAAAGGTTATTACGGAGACCACACCACA
GATATATTTAAAATTAGCGAGGATGCTCTTGACATGAGGAAGTCGATGAAGCGGGACGTACAACGGCAATATGTA
AGAAGCAATGGGAGGGATTATGAAGTCAATCCAGAGGATGTTTGGTAG
Gene >Hirsu2|6508
ATGGCGACATTTCGATCGTTTCGGCCGGACGATATTCATAAATTATCAAAGTGCAATTTCGATATATTAACGGAA
ACATATGAGCCTGGTTTTTATCTCCAATATTATGCGAAATGGGCGTCACTCTTCCAAGTGTGCGAAGACGTTAAT
GGAAACATCAATGGCTACAGTATGTGATCCTACAAGCCTATACAGAAGGTGTAGAGCTTCTTGTATATGACTAAA
TTCACAACGTAGTCATGGGCAAGGTCGAGTCTTCGCCCGATGCCTATAATTTTTCGGAGCATTATCTCCCGTGGC
ACGCTCATATTACAGCGTTGACGGTCGCCCCCGAAGCTCGCCGGCTTGGAATTGGTAAAATCTTGACTAGGCAGC
TAGAAGCCGCAGCTGACGCCAATGACGCCTGGTTCGTGGACCTCTTTGTCCGTCAAAGTAACGAAAGGGCTATCG
CATTCTATACGGACCTTGGTTACAATATATTCCGTCTTGTAAAAGGTTATTACGGAGACCACACCACAGATATAT
TTAAAATTAGCGAGGATGCTCTTGACATGAGGAAGTCGATGAAGCGGGACGTACAACGGCAATATGTAAGAAGCA
ATGGGAGGGATTATGAAGTCAATCCAGAGGATGTTTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail