Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6507
Gene name
LocationContig_3353:39..360
Strand+
Gene length (bp)321
Transcript length (bp)321
Coding sequence length (bp)321
Protein length (aa) 107

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03568 Peptidase_C50 Peptidase family C50 1.8E-07 1 20

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33144|BIMB_EMENI Separin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimB PE=4 SV=2 1 94 7.0E-18
sp|P18296|CUT1_SCHPO Separin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut1 PE=1 SV=3 1 97 5.0E-16
sp|Q03018|ESP1_YEAST Separin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESP1 PE=1 SV=2 1 95 2.0E-14
sp|Q5IBC5|ESP1_ARATH Separase OS=Arabidopsis thaliana GN=ESP1 PE=2 SV=1 1 102 2.0E-12
sp|Q14674|ESPL1_HUMAN Separin OS=Homo sapiens GN=ESPL1 PE=1 SV=3 1 95 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33144|BIMB_EMENI Separin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimB PE=4 SV=2 1 94 7.0E-18
sp|P18296|CUT1_SCHPO Separin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut1 PE=1 SV=3 1 97 5.0E-16
sp|Q03018|ESP1_YEAST Separin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESP1 PE=1 SV=2 1 95 2.0E-14
sp|Q5IBC5|ESP1_ARATH Separase OS=Arabidopsis thaliana GN=ESP1 PE=2 SV=1 1 102 2.0E-12
sp|Q14674|ESPL1_HUMAN Separin OS=Homo sapiens GN=ESPL1 PE=1 SV=3 1 95 1.0E-09
sp|P60330|ESPL1_MOUSE Separin OS=Mus musculus GN=Espl1 PE=1 SV=1 1 95 3.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 80 99 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6507
MMAGAPAVVGTLWDVTDRDIDRFAGRAFELWGLLQRGAFADGRRRNDDDAAGPGQTGKRQAAPSASLPEAVARAR
QACRFRYLNAAAAVVYGIPVYIAGDQGGSAE*
Coding >Hirsu2|6507
ATGATGGCCGGCGCGCCGGCCGTCGTCGGCACCCTGTGGGACGTGACGGACCGCGACATCGACCGCTTCGCCGGC
CGCGCCTTCGAGCTCTGGGGCCTGCTCCAGCGCGGCGCCTTTGCCGACGGCCGCCGCCGCAACGACGACGACGCC
GCCGGCCCCGGTCAGACCGGCAAGAGGCAGGCCGCGCCGTCCGCGTCGCTGCCCGAGGCCGTCGCCAGGGCCAGA
CAGGCCTGCCGGTTCCGCTACCTCAACGCAGCCGCCGCCGTCGTCTACGGCATCCCCGTCTACATCGCCGGCGAC
CAGGGCGGCAGCGCCGAGTGA
Transcript >Hirsu2|6507
ATGATGGCCGGCGCGCCGGCCGTCGTCGGCACCCTGTGGGACGTGACGGACCGCGACATCGACCGCTTCGCCGGC
CGCGCCTTCGAGCTCTGGGGCCTGCTCCAGCGCGGCGCCTTTGCCGACGGCCGCCGCCGCAACGACGACGACGCC
GCCGGCCCCGGTCAGACCGGCAAGAGGCAGGCCGCGCCGTCCGCGTCGCTGCCCGAGGCCGTCGCCAGGGCCAGA
CAGGCCTGCCGGTTCCGCTACCTCAACGCAGCCGCCGCCGTCGTCTACGGCATCCCCGTCTACATCGCCGGCGAC
CAGGGCGGCAGCGCCGAGTGA
Gene >Hirsu2|6507
ATGATGGCCGGCGCGCCGGCCGTCGTCGGCACCCTGTGGGACGTGACGGACCGCGACATCGACCGCTTCGCCGGC
CGCGCCTTCGAGCTCTGGGGCCTGCTCCAGCGCGGCGCCTTTGCCGACGGCCGCCGCCGCAACGACGACGACGCC
GCCGGCCCCGGTCAGACCGGCAAGAGGCAGGCCGCGCCGTCCGCGTCGCTGCCCGAGGCCGTCGCCAGGGCCAGA
CAGGCCTGCCGGTTCCGCTACCTCAACGCAGCCGCCGCCGTCGTCTACGGCATCCCCGTCTACATCGCCGGCGAC
CAGGGCGGCAGCGCCGAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail