Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6502
Gene name
LocationContig_335:16365..17841
Strand+
Gene length (bp)1476
Transcript length (bp)1476
Coding sequence length (bp)1476
Protein length (aa) 492

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 8.7E-36 44 433

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7N4|OXDA_SCHPO D-amino-acid oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dao1 PE=3 SV=1 43 435 2.0E-21
sp|O45307|OXDD1_CAEEL D-aspartate oxidase 1 OS=Caenorhabditis elegans GN=ddo-1 PE=1 SV=2 230 447 2.0E-11
sp|Q9Z1M5|OXDA_CAVPO D-amino-acid oxidase OS=Cavia porcellus GN=DAO PE=2 SV=1 45 439 2.0E-11
sp|Q99042|OXDA_TRIVR D-amino-acid oxidase OS=Trigonopsis variabilis GN=DAO1 PE=3 SV=1 45 438 7.0E-11
sp|Q556W1|OXDD_DICDI D-aspartate oxidase OS=Dictyostelium discoideum GN=ddo-1 PE=3 SV=1 226 438 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7N4|OXDA_SCHPO D-amino-acid oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dao1 PE=3 SV=1 43 435 2.0E-21
sp|O45307|OXDD1_CAEEL D-aspartate oxidase 1 OS=Caenorhabditis elegans GN=ddo-1 PE=1 SV=2 230 447 2.0E-11
sp|Q9Z1M5|OXDA_CAVPO D-amino-acid oxidase OS=Cavia porcellus GN=DAO PE=2 SV=1 45 439 2.0E-11
sp|Q99042|OXDA_TRIVR D-amino-acid oxidase OS=Trigonopsis variabilis GN=DAO1 PE=3 SV=1 45 438 7.0E-11
sp|Q556W1|OXDD_DICDI D-aspartate oxidase OS=Dictyostelium discoideum GN=ddo-1 PE=3 SV=1 226 438 3.0E-10
sp|P14920|OXDA_HUMAN D-amino-acid oxidase OS=Homo sapiens GN=DAO PE=1 SV=3 45 439 1.0E-09
sp|Q95XG9|OXDA_CAEEL D-amino-acid oxidase OS=Caenorhabditis elegans GN=daao-1 PE=1 SV=2 241 447 2.0E-09
sp|A8WXM1|OXDD1_CAEBR D-aspartate oxidase 1 OS=Caenorhabditis briggsae GN=CBG04460 PE=3 SV=1 230 442 5.0E-09
sp|P31228|OXDD_BOVIN D-aspartate oxidase OS=Bos taurus GN=DDO PE=1 SV=2 233 438 4.0E-08
sp|Q19564|OXDD2_CAEEL D-aspartate oxidase 2 OS=Caenorhabditis elegans GN=ddo-2 PE=1 SV=1 271 437 6.0E-08
sp|A8XJ44|OXDA_CAEBR D-amino-acid oxidase OS=Caenorhabditis briggsae GN=daao-1 PE=3 SV=1 241 439 8.0E-08
sp|Q99489|OXDD_HUMAN D-aspartate oxidase OS=Homo sapiens GN=DDO PE=2 SV=1 252 438 2.0E-07
sp|A3KCL7|OXDD_PIG D-aspartate oxidase OS=Sus scrofa GN=DDO PE=2 SV=1 272 429 3.0E-07
sp|O01739|OXDD3_CAEEL D-aspartate oxidase 3 OS=Caenorhabditis elegans GN=ddo-3 PE=1 SV=1 235 439 2.0E-06
sp|P00371|OXDA_PIG D-amino-acid oxidase OS=Sus scrofa GN=DAO PE=1 SV=2 226 429 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 45 62 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6502
MNGITHTDEVKLARREARNGFSYPEISLSTKGEPLTAVSADSKHVLVIGAGVSGLMVAWMLLDKGYRVTILADDW
AWTNDFERSRMTSQIAGALWEFPPGGCGLTEINETSGSGGWAAIEHYREWALQSYEFYQKYCCDVSNYHEDTGHS
FGLRFAKLHQFFYTDVNKPENENEYAKLQAIQEAKERMGEVEIHTREELRTKFKDIIQPDFQNQSLESAYSHRAP
IINTDKAMAYLMALVMAKGASMESRKLDKPIRDIGKQLLRDFDAQAIVNATGLGAKELANDPDVYPVRGAVRRVE
NTHRGQFRHLNDAYLVPAQRDENNHPTKTVFIVPRNDDVLYVGSIIQPNNDELKLTPDSPEVQVMWDRASEFMPS
LRHAGFCPGYPFAQGLRPFTTKNAKVRADENADFPLVHNYGHGGSGWTLGVGTARCAVAILEQLWDLGSSALKDK
AVAVNRDVCKPSDATEDSLAADPCQNKDKLFFKGLVRKNVV*
Coding >Hirsu2|6502
ATGAACGGAATTACCCATACTGACGAGGTAAAACTCGCCAGACGGGAAGCTCGCAACGGCTTTAGCTATCCAGAG
ATATCTCTCTCGACCAAAGGCGAGCCTTTGACGGCCGTCAGCGCCGACTCGAAACACGTTCTCGTCATCGGGGCC
GGCGTCAGCGGCCTGATGGTGGCCTGGATGCTCCTCGACAAGGGCTACCGAGTGACCATCCTTGCCGACGACTGG
GCCTGGACGAACGACTTCGAAAGGTCCCGCATGACGTCGCAGATCGCCGGTGCGCTCTGGGAGTTTCCCCCCGGC
GGGTGCGGCTTGACCGAGATCAACGAAACTTCCGGCTCCGGCGGGTGGGCTGCCATCGAGCACTACCGCGAGTGG
GCACTGCAGAGCTACGAGTTCTACCAGAAGTACTGCTGCGACGTGTCGAACTATCATGAGGACACCGGCCATTCG
TTTGGACTGCGATTCGCCAAGCTGCATCAATTCTTTTACACCGACGTCAACAAGCCCGAGAACGAGAACGAGTAC
GCGAAGCTGCAGGCGATCCAGGAGGCCAAAGAGCGGATGGGTGAAGTCGAGATCCACACCAGGGAGGAACTGAGG
ACAAAGTTTAAGGACATCATCCAGCCAGATTTCCAGAACCAGTCTCTCGAGAGCGCCTACAGTCACAGGGCCCCT
ATCATCAACACAGACAAGGCAATGGCCTACCTCATGGCCCTGGTGATGGCCAAGGGCGCGAGTATGGAGAGCCGG
AAGCTCGACAAGCCCATCAGAGACATTGGTAAGCAGCTGTTGAGAGACTTTGACGCCCAAGCCATCGTCAACGCC
ACCGGCCTCGGCGCCAAGGAGTTGGCCAACGACCCGGACGTGTACCCCGTCCGAGGAGCGGTCCGGCGTGTCGAA
AACACACACCGGGGCCAATTCAGGCACCTGAACGATGCGTACCTTGTCCCTGCGCAGCGGGACGAAAACAACCAC
CCGACAAAGACCGTCTTCATCGTCCCGCGCAACGACGACGTTCTGTACGTCGGCTCCATCATACAGCCCAACAAC
GACGAGCTGAAACTTACGCCGGATTCGCCCGAGGTCCAAGTCATGTGGGACCGCGCGAGTGAGTTCATGCCAAGC
CTGCGCCACGCCGGCTTCTGCCCCGGCTATCCGTTCGCCCAGGGCCTCCGGCCCTTCACCACCAAAAACGCAAAG
GTCAGGGCCGACGAGAATGCGGATTTCCCTCTGGTGCACAACTACGGCCACGGAGGCTCCGGTTGGACGCTTGGC
GTCGGAACCGCACGCTGTGCTGTGGCTATCCTGGAACAGCTATGGGATCTTGGCAGCTCTGCGCTGAAGGATAAA
GCAGTCGCGGTCAACAGGGACGTATGTAAACCCAGTGATGCCACCGAGGACTCGCTTGCAGCCGATCCTTGCCAA
AACAAGGACAAATTGTTCTTTAAAGGTCTGGTTCGAAAGAATGTTGTTTAG
Transcript >Hirsu2|6502
ATGAACGGAATTACCCATACTGACGAGGTAAAACTCGCCAGACGGGAAGCTCGCAACGGCTTTAGCTATCCAGAG
ATATCTCTCTCGACCAAAGGCGAGCCTTTGACGGCCGTCAGCGCCGACTCGAAACACGTTCTCGTCATCGGGGCC
GGCGTCAGCGGCCTGATGGTGGCCTGGATGCTCCTCGACAAGGGCTACCGAGTGACCATCCTTGCCGACGACTGG
GCCTGGACGAACGACTTCGAAAGGTCCCGCATGACGTCGCAGATCGCCGGTGCGCTCTGGGAGTTTCCCCCCGGC
GGGTGCGGCTTGACCGAGATCAACGAAACTTCCGGCTCCGGCGGGTGGGCTGCCATCGAGCACTACCGCGAGTGG
GCACTGCAGAGCTACGAGTTCTACCAGAAGTACTGCTGCGACGTGTCGAACTATCATGAGGACACCGGCCATTCG
TTTGGACTGCGATTCGCCAAGCTGCATCAATTCTTTTACACCGACGTCAACAAGCCCGAGAACGAGAACGAGTAC
GCGAAGCTGCAGGCGATCCAGGAGGCCAAAGAGCGGATGGGTGAAGTCGAGATCCACACCAGGGAGGAACTGAGG
ACAAAGTTTAAGGACATCATCCAGCCAGATTTCCAGAACCAGTCTCTCGAGAGCGCCTACAGTCACAGGGCCCCT
ATCATCAACACAGACAAGGCAATGGCCTACCTCATGGCCCTGGTGATGGCCAAGGGCGCGAGTATGGAGAGCCGG
AAGCTCGACAAGCCCATCAGAGACATTGGTAAGCAGCTGTTGAGAGACTTTGACGCCCAAGCCATCGTCAACGCC
ACCGGCCTCGGCGCCAAGGAGTTGGCCAACGACCCGGACGTGTACCCCGTCCGAGGAGCGGTCCGGCGTGTCGAA
AACACACACCGGGGCCAATTCAGGCACCTGAACGATGCGTACCTTGTCCCTGCGCAGCGGGACGAAAACAACCAC
CCGACAAAGACCGTCTTCATCGTCCCGCGCAACGACGACGTTCTGTACGTCGGCTCCATCATACAGCCCAACAAC
GACGAGCTGAAACTTACGCCGGATTCGCCCGAGGTCCAAGTCATGTGGGACCGCGCGAGTGAGTTCATGCCAAGC
CTGCGCCACGCCGGCTTCTGCCCCGGCTATCCGTTCGCCCAGGGCCTCCGGCCCTTCACCACCAAAAACGCAAAG
GTCAGGGCCGACGAGAATGCGGATTTCCCTCTGGTGCACAACTACGGCCACGGAGGCTCCGGTTGGACGCTTGGC
GTCGGAACCGCACGCTGTGCTGTGGCTATCCTGGAACAGCTATGGGATCTTGGCAGCTCTGCGCTGAAGGATAAA
GCAGTCGCGGTCAACAGGGACGTATGTAAACCCAGTGATGCCACCGAGGACTCGCTTGCAGCCGATCCTTGCCAA
AACAAGGACAAATTGTTCTTTAAAGGTCTGGTTCGAAAGAATGTTGTTTAG
Gene >Hirsu2|6502
ATGAACGGAATTACCCATACTGACGAGGTAAAACTCGCCAGACGGGAAGCTCGCAACGGCTTTAGCTATCCAGAG
ATATCTCTCTCGACCAAAGGCGAGCCTTTGACGGCCGTCAGCGCCGACTCGAAACACGTTCTCGTCATCGGGGCC
GGCGTCAGCGGCCTGATGGTGGCCTGGATGCTCCTCGACAAGGGCTACCGAGTGACCATCCTTGCCGACGACTGG
GCCTGGACGAACGACTTCGAAAGGTCCCGCATGACGTCGCAGATCGCCGGTGCGCTCTGGGAGTTTCCCCCCGGC
GGGTGCGGCTTGACCGAGATCAACGAAACTTCCGGCTCCGGCGGGTGGGCTGCCATCGAGCACTACCGCGAGTGG
GCACTGCAGAGCTACGAGTTCTACCAGAAGTACTGCTGCGACGTGTCGAACTATCATGAGGACACCGGCCATTCG
TTTGGACTGCGATTCGCCAAGCTGCATCAATTCTTTTACACCGACGTCAACAAGCCCGAGAACGAGAACGAGTAC
GCGAAGCTGCAGGCGATCCAGGAGGCCAAAGAGCGGATGGGTGAAGTCGAGATCCACACCAGGGAGGAACTGAGG
ACAAAGTTTAAGGACATCATCCAGCCAGATTTCCAGAACCAGTCTCTCGAGAGCGCCTACAGTCACAGGGCCCCT
ATCATCAACACAGACAAGGCAATGGCCTACCTCATGGCCCTGGTGATGGCCAAGGGCGCGAGTATGGAGAGCCGG
AAGCTCGACAAGCCCATCAGAGACATTGGTAAGCAGCTGTTGAGAGACTTTGACGCCCAAGCCATCGTCAACGCC
ACCGGCCTCGGCGCCAAGGAGTTGGCCAACGACCCGGACGTGTACCCCGTCCGAGGAGCGGTCCGGCGTGTCGAA
AACACACACCGGGGCCAATTCAGGCACCTGAACGATGCGTACCTTGTCCCTGCGCAGCGGGACGAAAACAACCAC
CCGACAAAGACCGTCTTCATCGTCCCGCGCAACGACGACGTTCTGTACGTCGGCTCCATCATACAGCCCAACAAC
GACGAGCTGAAACTTACGCCGGATTCGCCCGAGGTCCAAGTCATGTGGGACCGCGCGAGTGAGTTCATGCCAAGC
CTGCGCCACGCCGGCTTCTGCCCCGGCTATCCGTTCGCCCAGGGCCTCCGGCCCTTCACCACCAAAAACGCAAAG
GTCAGGGCCGACGAGAATGCGGATTTCCCTCTGGTGCACAACTACGGCCACGGAGGCTCCGGTTGGACGCTTGGC
GTCGGAACCGCACGCTGTGCTGTGGCTATCCTGGAACAGCTATGGGATCTTGGCAGCTCTGCGCTGAAGGATAAA
GCAGTCGCGGTCAACAGGGACGTATGTAAACCCAGTGATGCCACCGAGGACTCGCTTGCAGCCGATCCTTGCCAA
AACAAGGACAAATTGTTCTTTAAAGGTCTGGTTCGAAAGAATGTTGTTTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail