Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6500
Gene name
LocationContig_335:3904..8137
Strand-
Gene length (bp)4233
Transcript length (bp)4101
Coding sequence length (bp)4101
Protein length (aa) 1367

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02738 Ald_Xan_dh_C2 Molybdopterin-binding domain of aldehyde dehydrogenase 8.5E-206 733 1262
PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase 7.6E-46 260 437
PF01315 Ald_Xan_dh_C Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain 4.4E-32 605 714
PF01799 Fer2_2 [2Fe-2S] binding domain 3.0E-30 108 180
PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain 1.2E-29 446 549
PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain 5.8E-07 31 96

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5QE78|AOXB_RAT Aldehyde oxidase 2 OS=Rattus norvegicus GN=Aox2 PE=2 SV=1 26 1362 0.0E+00
sp|O54754|AOXA_MOUSE Aldehyde oxidase 1 OS=Mus musculus GN=Aox1 PE=1 SV=2 28 1362 0.0E+00
sp|Q9Z0U5|AOXA_RAT Aldehyde oxidase 1 OS=Rattus norvegicus GN=Aox1 PE=1 SV=1 28 1362 0.0E+00
sp|Q06278|AOXA_HUMAN Aldehyde oxidase OS=Homo sapiens GN=AOX1 PE=1 SV=2 28 1362 0.0E+00
sp|P80456|AOXA_RABIT Aldehyde oxidase 1 OS=Oryctolagus cuniculus GN=AOX1 PE=1 SV=2 28 1362 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5QE78|AOXB_RAT Aldehyde oxidase 2 OS=Rattus norvegicus GN=Aox2 PE=2 SV=1 26 1362 0.0E+00
sp|O54754|AOXA_MOUSE Aldehyde oxidase 1 OS=Mus musculus GN=Aox1 PE=1 SV=2 28 1362 0.0E+00
sp|Q9Z0U5|AOXA_RAT Aldehyde oxidase 1 OS=Rattus norvegicus GN=Aox1 PE=1 SV=1 28 1362 0.0E+00
sp|Q06278|AOXA_HUMAN Aldehyde oxidase OS=Homo sapiens GN=AOX1 PE=1 SV=2 28 1362 0.0E+00
sp|P80456|AOXA_RABIT Aldehyde oxidase 1 OS=Oryctolagus cuniculus GN=AOX1 PE=1 SV=2 28 1362 0.0E+00
sp|H9TB17|AOXA_CAVPO Aldehyde oxidase 1 OS=Cavia porcellus GN=AOX1 PE=1 SV=2 27 1362 0.0E+00
sp|Q5QE80|AOXC_RAT Aldehyde oxidase 3 OS=Rattus norvegicus GN=Aox3 PE=1 SV=1 22 1360 0.0E+00
sp|C4NYZ3|AOXB_MACFA Aldehyde oxidase 2 OS=Macaca fascicularis GN=AOX2 PE=2 SV=2 22 1362 0.0E+00
sp|Q3TYQ9|AOXD_MOUSE Aldehyde oxidase 4 OS=Mus musculus GN=Aox4 PE=1 SV=1 26 1362 0.0E+00
sp|Q5SGK3|AOXB_MOUSE Aldehyde oxidase 2 OS=Mus musculus GN=Aox2 PE=1 SV=2 22 1362 0.0E+00
sp|G3X982|AOXC_MOUSE Aldehyde oxidase 3 OS=Mus musculus GN=Aox3 PE=1 SV=1 22 1360 0.0E+00
sp|Q5QE79|AOXD_RAT Aldehyde oxidase 4 OS=Rattus norvegicus GN=Aox4 PE=2 SV=1 26 1362 0.0E+00
sp|H9TB19|AOXB_CAVPO Aldehyde oxidase 2 OS=Cavia porcellus GN=AOX2 PE=2 SV=2 26 1315 0.0E+00
sp|H9TB18|AOXD_CAVPO Aldehyde oxidase 4 OS=Cavia porcellus GN=AOX4 PE=2 SV=2 26 1362 0.0E+00
sp|Q7G191|ALDO4_ARATH Benzaldehyde dehydrogenase (NAD(+)) OS=Arabidopsis thaliana GN=AAO4 PE=1 SV=2 26 1311 0.0E+00
sp|Q7G193|ALDO1_ARATH Indole-3-acetaldehyde oxidase OS=Arabidopsis thaliana GN=AAO1 PE=1 SV=2 27 1350 0.0E+00
sp|Q12553|XDH_EMENI Xanthine dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hxA PE=2 SV=2 17 1366 0.0E+00
sp|P22985|XDH_RAT Xanthine dehydrogenase/oxidase OS=Rattus norvegicus GN=Xdh PE=1 SV=3 26 1366 0.0E+00
sp|R4ZGN4|XDH_BLAAD Xanthine dehydrogenase OS=Blastobotrys adeninivorans GN=AXOR PE=1 SV=1 23 1364 0.0E+00
sp|P47989|XDH_HUMAN Xanthine dehydrogenase/oxidase OS=Homo sapiens GN=XDH PE=1 SV=4 26 1347 0.0E+00
sp|P47990|XDH_CHICK Xanthine dehydrogenase/oxidase OS=Gallus gallus GN=XDH PE=1 SV=1 26 1349 0.0E+00
sp|Q9MYW6|XDH_FELCA Xanthine dehydrogenase/oxidase OS=Felis catus GN=XDH PE=2 SV=3 26 1349 0.0E+00
sp|Q00519|XDH_MOUSE Xanthine dehydrogenase/oxidase OS=Mus musculus GN=Xdh PE=1 SV=5 26 1366 0.0E+00
sp|Q5FB27|AOXA_MACFA Aldehyde oxidase 1 OS=Macaca fascicularis GN=AOX1 PE=2 SV=2 28 1357 0.0E+00
sp|P80457|XDH_BOVIN Xanthine dehydrogenase/oxidase OS=Bos taurus GN=XDH PE=1 SV=4 26 1347 0.0E+00
sp|P10351|XDH_DROME Xanthine dehydrogenase OS=Drosophila melanogaster GN=ry PE=2 SV=2 25 1347 0.0E+00
sp|P22811|XDH_DROPS Xanthine dehydrogenase OS=Drosophila pseudoobscura pseudoobscura GN=ry PE=3 SV=2 30 1358 0.0E+00
sp|P91711|XDH_DROSU Xanthine dehydrogenase OS=Drosophila subobscura GN=Xdh PE=3 SV=1 30 1358 0.0E+00
sp|Q54FB7|XDH_DICDI Xanthine dehydrogenase OS=Dictyostelium discoideum GN=xdh PE=3 SV=1 23 1352 0.0E+00
sp|P08793|XDH_CALVI Xanthine dehydrogenase OS=Calliphora vicina GN=XDH PE=2 SV=1 27 1346 0.0E+00
sp|Q6AUV1|XDH_ORYSJ Xanthine dehydrogenase OS=Oryza sativa subsp. japonica GN=XDH PE=2 SV=1 31 1350 0.0E+00
sp|Q8GUQ8|XDH1_ARATH Xanthine dehydrogenase 1 OS=Arabidopsis thaliana GN=XDH1 PE=1 SV=1 30 1347 0.0E+00
sp|F4JLI5|XDH2_ARATH Xanthine dehydrogenase 2 OS=Arabidopsis thaliana GN=XDH2 PE=2 SV=1 30 1347 0.0E+00
sp|P48034|AOXA_BOVIN Aldehyde oxidase 1 OS=Bos taurus GN=AOX1 PE=1 SV=2 28 1362 0.0E+00
sp|Q7G192|ALDO2_ARATH Indole-3-acetaldehyde oxidase OS=Arabidopsis thaliana GN=AAO2 PE=1 SV=2 27 1349 1.0E-179
sp|Q960A1|GAD3_CAEEL Probable aldehyde oxidase gad-3 OS=Caenorhabditis elegans GN=gad-3 PE=3 SV=3 28 1343 2.0E-179
sp|Q7G9P4|ALDO3_ARATH Abscisic-aldehyde oxidase OS=Arabidopsis thaliana GN=AAO3 PE=1 SV=1 28 1343 1.0E-171
sp|O23887|ALDO1_MAIZE Indole-3-acetaldehyde oxidase OS=Zea mays GN=AO1 PE=1 SV=1 27 1350 1.0E-169
sp|O23888|ALDO2_MAIZE Indole-3-acetaldehyde oxidase OS=Zea mays GN=AO2 PE=2 SV=1 32 1350 3.0E-166
sp|Q7XH05|ALDO1_ORYSJ Probable aldehyde oxidase 1 OS=Oryza sativa subsp. japonica GN=Os10g0138100 PE=2 SV=1 32 1350 4.0E-164
sp|Q6Z351|ALDOL_ORYSJ Putative aldehyde oxidase-like protein OS=Oryza sativa subsp. japonica GN=Os07g0281700 PE=3 SV=1 68 1350 5.0E-159
sp|Q852M2|ALDO3_ORYSJ Probable aldehyde oxidase 3 OS=Oryza sativa subsp. japonica GN=Os03g0790700 PE=3 SV=1 33 1350 2.0E-157
sp|Q852M1|ALDO2_ORYSJ Probable aldehyde oxidase 2 OS=Oryza sativa subsp. japonica GN=Os03g0790900 PE=2 SV=1 32 1350 3.0E-157
sp|Q69R21|ALDO4_ORYSJ Probable aldehyde oxidase 4 OS=Oryza sativa subsp. japonica GN=Os07g0282300 PE=2 SV=1 28 827 1.0E-70
sp|O32144|XDHD_BACSU Probable xanthine dehydrogenase subunit D OS=Bacillus subtilis (strain 168) GN=pucD PE=2 SV=1 603 1306 2.0E-54
sp|O33819|HCRA_THAAR 4-hydroxybenzoyl-CoA reductase subunit alpha OS=Thauera aromatica GN=hcrA PE=1 SV=1 592 1262 1.0E-52
sp|Q0QLF2|NDLMS_EUBBA Nicotinate dehydrogenase large molybdopterin subunit OS=Eubacterium barkeri GN=ndhL PE=1 SV=1 589 982 7.0E-49
sp|Q8XD64|XDHD_ECO57 Probable hypoxanthine oxidase XdhD OS=Escherichia coli O157:H7 GN=xdhD PE=3 SV=1 589 1270 5.0E-46
sp|Q46814|XDHD_ECOLI Probable hypoxanthine oxidase XdhD OS=Escherichia coli (strain K12) GN=xdhD PE=3 SV=1 589 1270 2.0E-45
sp|Q8X6C7|XDHA_ECO57 Xanthine dehydrogenase molybdenum-binding subunit OS=Escherichia coli O157:H7 GN=xdhA PE=3 SV=1 598 1309 6.0E-44
sp|Q46509|MOP_DESGI Aldehyde oxidoreductase OS=Desulfovibrio gigas GN=mop PE=1 SV=1 587 1232 7.0E-44
sp|Q46799|XDHA_ECOLI Xanthine dehydrogenase molybdenum-binding subunit OS=Escherichia coli (strain K12) GN=xdhA PE=2 SV=1 598 1309 2.0E-43
sp|D7REY3|CDHA_PSEU3 Caffeine dehydrogenase subunit alpha OS=Pseudomonas sp. (strain CBB1) GN=cdhA PE=1 SV=1 591 1259 3.0E-40
sp|P19919|DCML_OLICO Carbon monoxide dehydrogenase large chain OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=coxL PE=1 SV=2 598 1305 1.0E-37
sp|Q933N0|KDHC_ARTNI 6-hydroxypseudooxynicotine dehydrogenase complex subunit gamma OS=Arthrobacter nicotinovorans GN=kdhC PE=1 SV=1 605 1263 7.0E-36
sp|P19913|DCML_HYDPS Carbon monoxide dehydrogenase large chain OS=Hydrogenophaga pseudoflava GN=cutL PE=1 SV=2 606 1306 6.0E-33
sp|Q4J6M3|CUTA_SULAC Glyceraldehyde dehydrogenase large chain OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cutA PE=1 SV=1 591 1308 3.0E-32
sp|Q4J6M5|CUTC_SULAC Glyceraldehyde dehydrogenase small chain OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cutC PE=1 SV=1 42 180 2.0E-26
sp|P19915|DCMS_HYDPS Carbon monoxide dehydrogenase small chain OS=Hydrogenophaga pseudoflava GN=cutS PE=1 SV=2 42 181 3.0E-25
sp|O33818|HCRC_THAAR 4-hydroxybenzoyl-CoA reductase subunit gamma OS=Thauera aromatica GN=hcrC PE=1 SV=1 24 173 2.0E-24
sp|P77489|YAGR_ECOLI Putative xanthine dehydrogenase YagR molybdenum-binding subunit OS=Escherichia coli (strain K12) GN=yagR PE=3 SV=1 589 1289 4.0E-24
sp|Q8X6J4|YAGR_ECO57 Putative xanthine dehydrogenase YagR molybdenum-binding subunit OS=Escherichia coli O157:H7 GN=yagR PE=3 SV=1 589 1289 7.0E-24
sp|Q46509|MOP_DESGI Aldehyde oxidoreductase OS=Desulfovibrio gigas GN=mop PE=1 SV=1 42 241 8.0E-24
sp|Q0QLF1|NDMMS_EUBBA Nicotinate dehydrogenase medium molybdopterin subunit OS=Eubacterium barkeri GN=ndhM PE=1 SV=1 1015 1306 1.0E-23
sp|Q0QLF3|NDSFS_EUBBA Nicotinate dehydrogenase small FeS subunit OS=Eubacterium barkeri GN=ndhS PE=1 SV=1 27 190 5.0E-23
sp|Q88FX9|NICA_PSEPK Nicotinate dehydrogenase subunit A OS=Pseudomonas putida (strain KT2440) GN=nicA PE=1 SV=1 24 181 7.0E-22
sp|Q51697|IORA_BREDI Isoquinoline 1-oxidoreductase subunit alpha OS=Brevundimonas diminuta GN=iorA PE=1 SV=1 28 176 6.0E-21
sp|O32143|XDHE_BACSU Probable xanthine dehydrogenase subunit E OS=Bacillus subtilis (strain 168) GN=pucE PE=2 SV=1 57 180 5.0E-20
sp|P77165|YAGT_ECOLI Putative xanthine dehydrogenase YagT iron-sulfur-binding subunit OS=Escherichia coli (strain K12) GN=yagT PE=1 SV=1 28 181 3.0E-19
sp|Q8X6I9|YAGT_ECO57 Putative xanthine dehydrogenase YagT iron-sulfur-binding subunit OS=Escherichia coli O157:H7 GN=yagT PE=3 SV=1 41 181 5.0E-19
sp|Q0QLF4|NDFS_EUBBA Nicotinate dehydrogenase FAD-subunit OS=Eubacterium barkeri GN=ndhF PE=1 SV=1 261 558 5.0E-19
sp|Q8X6C4|XDHC_ECO57 Xanthine dehydrogenase iron-sulfur-binding subunit OS=Escherichia coli O157:H7 GN=xdhC PE=3 SV=1 27 178 3.0E-18
sp|P19921|DCMS_OLICO Carbon monoxide dehydrogenase small chain OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=coxS PE=1 SV=2 28 181 6.0E-18
sp|O87682|KDHB_ARTNI 6-hydroxypseudooxynicotine dehydrogenase complex subunit beta OS=Arthrobacter nicotinovorans GN=kdhB PE=1 SV=1 41 179 8.0E-18
sp|Q46801|XDHC_ECOLI Xanthine dehydrogenase iron-sulfur-binding subunit OS=Escherichia coli (strain K12) GN=xdhC PE=3 SV=1 27 178 1.0E-17
sp|D7REY5|CDHC_PSEU3 Caffeine dehydrogenase subunit gamma OS=Pseudomonas sp. (strain CBB1) GN=cdhC PE=1 SV=1 28 184 2.0E-17
sp|Q46800|XDHB_ECOLI Xanthine dehydrogenase FAD-binding subunit OS=Escherichia coli (strain K12) GN=xdhB PE=3 SV=1 261 520 3.0E-10
sp|Q8X6C5|XDHB_ECO57 Xanthine dehydrogenase FAD-binding subunit OS=Escherichia coli O157:H7 GN=xdhB PE=3 SV=1 261 520 3.0E-10
sp|P17201|DHAQ_GLUPO Membrane-bound aldehyde dehydrogenase [pyrroloquinoline-quinone] OS=Gluconacetobacter polyoxogenes PE=1 SV=1 629 890 9.0E-10
sp|D7REY4|CDHB_PSEU3 Caffeine dehydrogenase subunit beta OS=Pseudomonas sp. (strain CBB1) GN=cdhB PE=1 SV=1 249 474 2.0E-08
sp|Q4J6M6|CUTB_SULAC Glyceraldehyde dehydrogenase medium chain OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cutB PE=1 SV=1 305 506 2.0E-08
sp|Q51698|IORB_BREDI Isoquinoline 1-oxidoreductase subunit beta OS=Brevundimonas diminuta GN=iorB PE=1 SV=1 765 983 7.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0009055 electron transfer activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:0051540 metal cluster binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6500
MAPAAVTPEKESQPALLASLTAKFDDTIRFYLNGTKVVLDDIDPEVTVLEYLRGIGLTGTKLGCGEGGCGACTIV
VSQYNPTTRQIYHASVNACLAPLASLDGKHVITIEGIGNTKRPHPTQERVAKGNGSQCGFCTPGIVMSLYALLRN
NSDPTQDEIEEAFDGNLCRCTGYRPILDAAQTFSVDKPAQGRSGCCMADGKGPPDGVCCMQKKKTPDSQPIKRFT
PPGFIEYNPDTELIFPPALKKHELRPLAFGSKRKRWYRPVTLDQLLQIKSVHPQAKIIGGSTETQIEIKFKALQY
PVSVYVGDIPELRQFALGDSHVEVGGNVVLTDLEGICEKAIRRYGHVRGQVFEGILKQLKFFAGRQIRNVGTPAG
NLVTASPISDLNPVLWAANAVLVAKSAAEETETEIPMSQFFTGYRKTALPQDAIIASIRIPVTAEKGEFFRAYKQ
AKRKDDDIAIVTGALRVKLDGAGVVTQCALIYGGMAALTVSAKTATQFLVGKRFAELETLEGAMSALGEDFDMQF
SVPGGMASYRKALALGFFYRFYHDVLTNLDGRCKHVDKEAIDELERSISKGMVDEKSSVAYEKEVTGKANPHVAA
LKQTTGEAQYTDDIPSLKNELHGCWVLSTRAHARIKSIDYSAALDMPGVVDYVDRSDMPSAEANKFGAPHFDEVF
FAEGEVHTAGQPIAMVLATSASRAQEAARAVKIEYENLPAVLTMEEAIEQDSFHPLFREIKRGDAERAFKTCDHV
FTGTARMGGQEHFYLETNACLVVPKPEDGEMEIFASTQNPNETQVFASRVCEVEANKVVVRVKRLGGGFGGKETR
SVLLSSAAALAARKTGRPIRCMLTREEDMITMGQRHPFMARYKVGVNKDGRIQALDLDIFNNAGWTFDLSASVVE
RAMTHSDGCYDIPHVHVRGRICKTNTVSNTAFRGFGGPQGMFIAETYMEETADRLGMPVERLREVNFYKPRGVTH
FNQTLEDWHVPLMYQQVQDESGYGQRRAMVDAFNGDYKWRKRGLALIPTKFGISFTALFLNQAGALVHIYHDGSI
LVAHGGTEMGQGLHTKLSQIAAQALSVPLESVFISETATNTVANASATAASASSDLNGYAIYNACRQLNERLAPY
REKLGPGATMKALAHAAYFDRVNLSAQGFYKTPDIGYVWGENKGKMFFYFTQGVAAAEVEVDTLTGTWTCLRADI
KMDVGQSINPSIDYGQIQGAFVQGMGLFTMEESLWLRNGPMAGNLFTRGPGAYKIPGFRDIPQEFNVRLLKDVEW
KELRTIQRSRGVGEPPLFLGSAVFFAIRDALRAARRAAGVEVTAGDGGDAGLLRLESPATPERIRLACEDEIMRR
ARVVPKEGEKSFFVAI*
Coding >Hirsu2|6500
ATGGCGCCCGCCGCCGTGACCCCGGAGAAAGAGTCCCAGCCGGCCCTGCTAGCGTCTCTAACGGCAAAGTTTGAC
GACACTATCAGGTTCTACCTCAACGGGACCAAGGTGGTTCTCGACGACATCGACCCCGAGGTCACCGTCCTCGAG
TACCTCCGCGGAATTGGCCTGACCGGTACCAAGCTTGGCTGCGGCGAGGGTGGCTGCGGCGCCTGCACCATCGTT
GTGAGCCAATACAACCCGACGACCCGGCAAATCTACCATGCAAGCGTCAATGCTTGTCTGGCGCCCCTGGCCAGC
CTCGATGGCAAGCACGTCATCACCATTGAGGGCATCGGAAATACCAAACGCCCTCATCCTACGCAGGAGCGCGTC
GCCAAAGGAAATGGAAGCCAATGCGGCTTCTGCACCCCCGGAATTGTCATGAGTCTGTACGCGCTTCTGCGTAAC
AACTCCGATCCTACCCAGGACGAGATCGAGGAGGCCTTCGACGGCAACCTGTGCCGGTGCACCGGCTACCGCCCC
ATCCTAGACGCCGCCCAGACCTTTAGCGTCGACAAGCCGGCACAGGGCCGCTCCGGCTGCTGCATGGCGGACGGC
AAGGGACCTCCCGATGGCGTCTGCTGCATGCAGAAGAAGAAGACGCCGGACAGCCAGCCAATCAAACGCTTCACT
CCCCCCGGCTTCATCGAATACAACCCTGACACCGAGCTCATCTTCCCCCCGGCACTCAAGAAGCACGAACTGCGC
CCGCTGGCCTTCGGCAGCAAGCGGAAAAGGTGGTACCGGCCTGTCACTCTCGACCAGCTCCTTCAGATCAAGAGC
GTGCACCCACAGGCCAAAATCATCGGGGGCAGCACAGAGACGCAGATCGAGATCAAGTTCAAGGCGTTGCAGTAC
CCCGTCTCCGTCTACGTCGGAGACATCCCAGAGCTGCGACAGTTCGCCCTGGGCGACAGCCACGTCGAGGTCGGC
GGAAACGTTGTCTTGACCGACCTCGAGGGTATCTGCGAAAAGGCCATCCGTCGTTACGGCCACGTGCGAGGTCAG
GTGTTTGAGGGGATTTTGAAGCAGCTCAAGTTCTTCGCCGGAAGACAGATCCGGAACGTTGGCACACCCGCCGGC
AATCTTGTGACCGCCTCGCCCATCTCGGACTTGAACCCGGTGCTGTGGGCGGCGAATGCCGTGCTGGTGGCCAAG
TCGGCCGCCGAGGAGACGGAGACGGAGATACCCATGAGCCAGTTCTTTACTGGGTATCGCAAGACTGCTCTCCCT
CAAGACGCCATCATCGCATCTATCCGCATCCCGGTCACCGCCGAGAAGGGAGAGTTCTTCCGCGCATACAAACAG
GCGAAGCGCAAGGATGACGACATTGCCATCGTCACGGGCGCGTTGAGGGTCAAGCTGGACGGCGCGGGCGTCGTC
ACGCAATGCGCCTTAATCTACGGCGGGATGGCCGCCTTGACCGTGTCGGCCAAGACGGCCACCCAGTTCCTCGTC
GGGAAGCGCTTCGCCGAGCTCGAGACGCTTGAAGGAGCCATGAGCGCCTTGGGCGAGGACTTTGACATGCAATTC
AGCGTTCCTGGAGGCATGGCCTCGTATCGAAAGGCCCTCGCTCTCGGCTTCTTCTATCGCTTCTACCACGACGTG
CTCACGAATCTGGACGGACGGTGCAAGCACGTTGATAAGGAGGCCATCGACGAGCTCGAACGCTCTATTTCCAAG
GGTATGGTGGACGAGAAGTCGTCCGTGGCGTACGAAAAGGAGGTGACGGGCAAAGCAAACCCCCACGTAGCCGCG
CTCAAGCAGACAACGGGAGAGGCCCAATACACCGATGATATCCCTTCTTTGAAGAACGAGTTGCACGGCTGCTGG
GTCTTGTCTACCAGGGCGCATGCGCGGATCAAATCGATCGATTACTCTGCGGCGCTCGACATGCCCGGCGTCGTC
GATTACGTCGACAGAAGCGACATGCCATCCGCCGAAGCCAACAAGTTCGGCGCTCCTCACTTCGACGAGGTCTTC
TTCGCAGAGGGGGAGGTCCACACGGCCGGCCAGCCGATCGCCATGGTTCTGGCCACGTCCGCCTCGAGGGCACAG
GAGGCGGCCCGAGCCGTCAAAATCGAGTACGAAAATCTTCCGGCGGTGCTCACGATGGAAGAGGCAATCGAACAG
GACAGCTTCCACCCTTTGTTCCGAGAAATCAAGCGGGGAGACGCCGAAAGGGCATTCAAGACTTGTGATCACGTC
TTCACGGGCACCGCCAGGATGGGCGGGCAGGAGCACTTCTACCTGGAGACCAATGCCTGCCTCGTCGTACCGAAG
CCTGAGGATGGCGAGATGGAAATATTTGCCAGCACGCAAAACCCTAACGAGACACAGGTGTTCGCGTCACGTGTG
TGCGAAGTGGAAGCAAACAAGGTCGTCGTACGCGTCAAGAGGCTCGGCGGCGGCTTCGGCGGTAAGGAGACTCGA
TCGGTTCTCCTGAGCTCGGCCGCGGCGCTGGCGGCGAGGAAGACGGGGCGGCCGATTCGGTGCATGCTTACGCGC
GAGGAGGACATGATCACGATGGGCCAGAGGCATCCCTTCATGGCGCGGTACAAGGTCGGCGTCAACAAGGACGGC
CGGATACAGGCGCTCGACCTCGACATCTTCAACAATGCCGGCTGGACGTTCGACCTGAGCGCCAGCGTGGTCGAG
CGTGCCATGACGCATAGCGACGGCTGTTACGACATCCCCCACGTGCACGTCCGCGGTCGCATCTGCAAGACCAAT
ACCGTTTCCAATACGGCCTTCCGCGGCTTCGGAGGTCCCCAGGGCATGTTCATCGCCGAGACATACATGGAAGAG
ACGGCAGACCGGCTGGGCATGCCCGTGGAGCGGCTGCGGGAGGTGAATTTCTACAAGCCGCGCGGCGTCACGCAC
TTCAACCAGACGCTCGAGGACTGGCACGTCCCCCTGATGTACCAGCAAGTGCAGGACGAGTCGGGCTACGGCCAG
CGGCGGGCCATGGTGGACGCGTTCAATGGCGACTACAAGTGGCGCAAGAGAGGGCTGGCCCTAATCCCGACCAAG
TTCGGCATATCCTTCACGGCCCTCTTCCTCAACCAGGCCGGCGCGCTGGTGCACATCTACCACGATGGCTCCATC
CTGGTGGCGCATGGCGGCACGGAGATGGGCCAGGGCCTGCACACGAAGCTCTCGCAGATTGCGGCCCAGGCCCTG
TCGGTGCCGCTCGAGAGCGTCTTCATCTCGGAGACGGCGACGAACACGGTAGCCAACGCGTCGGCAACGGCGGCG
TCGGCGTCGTCGGACCTGAACGGCTACGCCATCTACAACGCCTGCCGACAGCTGAACGAGCGGCTGGCGCCGTAC
CGCGAGAAGCTGGGGCCCGGGGCGACGATGAAGGCGCTCGCGCACGCGGCCTACTTTGACCGGGTCAACCTGTCG
GCGCAGGGCTTCTACAAGACGCCGGACATTGGGTACGTGTGGGGCGAAAACAAGGGCAAGATGTTCTTCTACTTC
ACGCAGGGCGTCGCGGCGGCCGAGGTCGAGGTGGACACGCTGACGGGGACGTGGACGTGCTTGCGGGCCGACATC
AAGATGGACGTGGGCCAGTCCATCAACCCGTCGATCGACTACGGGCAGATCCAGGGGGCCTTTGTGCAGGGCATG
GGCCTCTTTACCATGGAGGAGTCGCTGTGGCTCCGCAACGGGCCCATGGCCGGCAATCTGTTCACGCGCGGCCCC
GGCGCGTACAAAATCCCCGGCTTCCGCGACATTCCGCAGGAGTTCAACGTGAGGCTGCTCAAGGACGTGGAGTGG
AAGGAGCTGCGGACGATCCAGCGCAGCAGGGGCGTGGGCGAGCCGCCACTGTTTCTCGGCAGTGCCGTCTTCTTC
GCCATCCGAGACGCGCTGAGGGCGGCGAGGAGGGCGGCCGGGGTCGAGGTGACGGCGGGCGACGGCGGCGACGCA
GGGCTGCTGAGGCTAGAGAGCCCGGCGACGCCTGAGCGGATCAGGCTGGCATGTGAGGACGAGATTATGCGGCGC
GCGCGGGTGGTGCCCAAGGAAGGCGAGAAGAGCTTCTTCGTGGCCATCTAG
Transcript >Hirsu2|6500
ATGGCGCCCGCCGCCGTGACCCCGGAGAAAGAGTCCCAGCCGGCCCTGCTAGCGTCTCTAACGGCAAAGTTTGAC
GACACTATCAGGTTCTACCTCAACGGGACCAAGGTGGTTCTCGACGACATCGACCCCGAGGTCACCGTCCTCGAG
TACCTCCGCGGAATTGGCCTGACCGGTACCAAGCTTGGCTGCGGCGAGGGTGGCTGCGGCGCCTGCACCATCGTT
GTGAGCCAATACAACCCGACGACCCGGCAAATCTACCATGCAAGCGTCAATGCTTGTCTGGCGCCCCTGGCCAGC
CTCGATGGCAAGCACGTCATCACCATTGAGGGCATCGGAAATACCAAACGCCCTCATCCTACGCAGGAGCGCGTC
GCCAAAGGAAATGGAAGCCAATGCGGCTTCTGCACCCCCGGAATTGTCATGAGTCTGTACGCGCTTCTGCGTAAC
AACTCCGATCCTACCCAGGACGAGATCGAGGAGGCCTTCGACGGCAACCTGTGCCGGTGCACCGGCTACCGCCCC
ATCCTAGACGCCGCCCAGACCTTTAGCGTCGACAAGCCGGCACAGGGCCGCTCCGGCTGCTGCATGGCGGACGGC
AAGGGACCTCCCGATGGCGTCTGCTGCATGCAGAAGAAGAAGACGCCGGACAGCCAGCCAATCAAACGCTTCACT
CCCCCCGGCTTCATCGAATACAACCCTGACACCGAGCTCATCTTCCCCCCGGCACTCAAGAAGCACGAACTGCGC
CCGCTGGCCTTCGGCAGCAAGCGGAAAAGGTGGTACCGGCCTGTCACTCTCGACCAGCTCCTTCAGATCAAGAGC
GTGCACCCACAGGCCAAAATCATCGGGGGCAGCACAGAGACGCAGATCGAGATCAAGTTCAAGGCGTTGCAGTAC
CCCGTCTCCGTCTACGTCGGAGACATCCCAGAGCTGCGACAGTTCGCCCTGGGCGACAGCCACGTCGAGGTCGGC
GGAAACGTTGTCTTGACCGACCTCGAGGGTATCTGCGAAAAGGCCATCCGTCGTTACGGCCACGTGCGAGGTCAG
GTGTTTGAGGGGATTTTGAAGCAGCTCAAGTTCTTCGCCGGAAGACAGATCCGGAACGTTGGCACACCCGCCGGC
AATCTTGTGACCGCCTCGCCCATCTCGGACTTGAACCCGGTGCTGTGGGCGGCGAATGCCGTGCTGGTGGCCAAG
TCGGCCGCCGAGGAGACGGAGACGGAGATACCCATGAGCCAGTTCTTTACTGGGTATCGCAAGACTGCTCTCCCT
CAAGACGCCATCATCGCATCTATCCGCATCCCGGTCACCGCCGAGAAGGGAGAGTTCTTCCGCGCATACAAACAG
GCGAAGCGCAAGGATGACGACATTGCCATCGTCACGGGCGCGTTGAGGGTCAAGCTGGACGGCGCGGGCGTCGTC
ACGCAATGCGCCTTAATCTACGGCGGGATGGCCGCCTTGACCGTGTCGGCCAAGACGGCCACCCAGTTCCTCGTC
GGGAAGCGCTTCGCCGAGCTCGAGACGCTTGAAGGAGCCATGAGCGCCTTGGGCGAGGACTTTGACATGCAATTC
AGCGTTCCTGGAGGCATGGCCTCGTATCGAAAGGCCCTCGCTCTCGGCTTCTTCTATCGCTTCTACCACGACGTG
CTCACGAATCTGGACGGACGGTGCAAGCACGTTGATAAGGAGGCCATCGACGAGCTCGAACGCTCTATTTCCAAG
GGTATGGTGGACGAGAAGTCGTCCGTGGCGTACGAAAAGGAGGTGACGGGCAAAGCAAACCCCCACGTAGCCGCG
CTCAAGCAGACAACGGGAGAGGCCCAATACACCGATGATATCCCTTCTTTGAAGAACGAGTTGCACGGCTGCTGG
GTCTTGTCTACCAGGGCGCATGCGCGGATCAAATCGATCGATTACTCTGCGGCGCTCGACATGCCCGGCGTCGTC
GATTACGTCGACAGAAGCGACATGCCATCCGCCGAAGCCAACAAGTTCGGCGCTCCTCACTTCGACGAGGTCTTC
TTCGCAGAGGGGGAGGTCCACACGGCCGGCCAGCCGATCGCCATGGTTCTGGCCACGTCCGCCTCGAGGGCACAG
GAGGCGGCCCGAGCCGTCAAAATCGAGTACGAAAATCTTCCGGCGGTGCTCACGATGGAAGAGGCAATCGAACAG
GACAGCTTCCACCCTTTGTTCCGAGAAATCAAGCGGGGAGACGCCGAAAGGGCATTCAAGACTTGTGATCACGTC
TTCACGGGCACCGCCAGGATGGGCGGGCAGGAGCACTTCTACCTGGAGACCAATGCCTGCCTCGTCGTACCGAAG
CCTGAGGATGGCGAGATGGAAATATTTGCCAGCACGCAAAACCCTAACGAGACACAGGTGTTCGCGTCACGTGTG
TGCGAAGTGGAAGCAAACAAGGTCGTCGTACGCGTCAAGAGGCTCGGCGGCGGCTTCGGCGGTAAGGAGACTCGA
TCGGTTCTCCTGAGCTCGGCCGCGGCGCTGGCGGCGAGGAAGACGGGGCGGCCGATTCGGTGCATGCTTACGCGC
GAGGAGGACATGATCACGATGGGCCAGAGGCATCCCTTCATGGCGCGGTACAAGGTCGGCGTCAACAAGGACGGC
CGGATACAGGCGCTCGACCTCGACATCTTCAACAATGCCGGCTGGACGTTCGACCTGAGCGCCAGCGTGGTCGAG
CGTGCCATGACGCATAGCGACGGCTGTTACGACATCCCCCACGTGCACGTCCGCGGTCGCATCTGCAAGACCAAT
ACCGTTTCCAATACGGCCTTCCGCGGCTTCGGAGGTCCCCAGGGCATGTTCATCGCCGAGACATACATGGAAGAG
ACGGCAGACCGGCTGGGCATGCCCGTGGAGCGGCTGCGGGAGGTGAATTTCTACAAGCCGCGCGGCGTCACGCAC
TTCAACCAGACGCTCGAGGACTGGCACGTCCCCCTGATGTACCAGCAAGTGCAGGACGAGTCGGGCTACGGCCAG
CGGCGGGCCATGGTGGACGCGTTCAATGGCGACTACAAGTGGCGCAAGAGAGGGCTGGCCCTAATCCCGACCAAG
TTCGGCATATCCTTCACGGCCCTCTTCCTCAACCAGGCCGGCGCGCTGGTGCACATCTACCACGATGGCTCCATC
CTGGTGGCGCATGGCGGCACGGAGATGGGCCAGGGCCTGCACACGAAGCTCTCGCAGATTGCGGCCCAGGCCCTG
TCGGTGCCGCTCGAGAGCGTCTTCATCTCGGAGACGGCGACGAACACGGTAGCCAACGCGTCGGCAACGGCGGCG
TCGGCGTCGTCGGACCTGAACGGCTACGCCATCTACAACGCCTGCCGACAGCTGAACGAGCGGCTGGCGCCGTAC
CGCGAGAAGCTGGGGCCCGGGGCGACGATGAAGGCGCTCGCGCACGCGGCCTACTTTGACCGGGTCAACCTGTCG
GCGCAGGGCTTCTACAAGACGCCGGACATTGGGTACGTGTGGGGCGAAAACAAGGGCAAGATGTTCTTCTACTTC
ACGCAGGGCGTCGCGGCGGCCGAGGTCGAGGTGGACACGCTGACGGGGACGTGGACGTGCTTGCGGGCCGACATC
AAGATGGACGTGGGCCAGTCCATCAACCCGTCGATCGACTACGGGCAGATCCAGGGGGCCTTTGTGCAGGGCATG
GGCCTCTTTACCATGGAGGAGTCGCTGTGGCTCCGCAACGGGCCCATGGCCGGCAATCTGTTCACGCGCGGCCCC
GGCGCGTACAAAATCCCCGGCTTCCGCGACATTCCGCAGGAGTTCAACGTGAGGCTGCTCAAGGACGTGGAGTGG
AAGGAGCTGCGGACGATCCAGCGCAGCAGGGGCGTGGGCGAGCCGCCACTGTTTCTCGGCAGTGCCGTCTTCTTC
GCCATCCGAGACGCGCTGAGGGCGGCGAGGAGGGCGGCCGGGGTCGAGGTGACGGCGGGCGACGGCGGCGACGCA
GGGCTGCTGAGGCTAGAGAGCCCGGCGACGCCTGAGCGGATCAGGCTGGCATGTGAGGACGAGATTATGCGGCGC
GCGCGGGTGGTGCCCAAGGAAGGCGAGAAGAGCTTCTTCGTGGCCATCTAG
Gene >Hirsu2|6500
ATGGCGCCCGCCGCCGTGACCCCGGAGAAAGAGTCCCAGCCGGCCCTGCTAGCGTCTCTAACGGCAAAGTTTGAC
GACACTATCAGGTTCTACCTCAACGGGACCAAGGTGGTTCTCGACGACATCGACCCCGAGGTCACCGTCCTCGAG
TACCTCCGCGGAATTGGCCTGACCGGTACCAAGCTGTACGTCGTGTTCGCCCCCCTTGATCTTGATCTTCTCTCC
GACTCACCTCTGCTTGCCCTGCATTCAGTGGCTGCGGCGAGGGTGGCTGCGGCGCCTGCACCATCGTTGTGAGCC
AATACAACCCGACGACCCGGCAAATCTACCATGCAAGCGTCAATGCTTGTCTGGCGCCCCTGGCCAGCCTCGATG
GCAAGCACGTCATCACCATTGAGGGCATCGGAAATACCAAACGCCCTCATCCTACGCAGGAGCGCGTCGCCAAAG
GAAATGGAAGCCAATGCGGCTTCTGCACCCCCGGAATTGTCATGAGTCTGTACGCGCTTCTGCGTAACAACTCCG
ATCCTACCCAGGACGAGATCGAGGAGGCCTTCGACGGCAACCTGTGCCGGTGCACCGGCTACCGCCCCATCCTAG
ACGCCGCCCAGACCTTTAGCGTCGACAAGCCGGCACAGGGCCGCTCCGGCTGCTGCATGGCGGACGGCAAGGGAC
CTCCCGATGGCGTCTGCTGCATGCAGAAGAAGAAGACGCCGGACAGCCAGCCAATCAAACGCTTCACTCCCCCCG
GCTTCATCGAATACAACCCTGACACCGAGCTCATCTTCCCCCCGGCACTCAAGAAGCACGAACTGCGCCCGCTGG
CCTTCGGCAGCAAGCGGAAAAGGTGGTACCGGCCTGTCACTCTCGACCAGCTCCTTCAGATCAAGAGCGTGCACC
CACAGGCCAAAATCATCGGGGGCAGCACAGAGACGCAGATCGAGATCAAGTTCAAGGCGTTGCAGTACCCCGTCT
CCGTCTACGTCGGAGACATCCCAGAGCTGCGACAGTTCGCCCTGGGCGACAGCCACGTCGAGGTCGGCGGAAACG
TTGTCTTGACCGACCTCGAGGGTATCTGCGAAAAGGCCATCCGTCGTTACGGCCACGTGCGAGGTCAGGTGTTTG
AGGGGATTTTGAAGCAGCTCAAGTTCTTCGCCGGAAGACAGATCCGGAACGTTGGCACACCCGCCGGCAATCTTG
TGACCGCCTCGCCCATCTCGGACTTGAACCCGGTGCTGTGGGCGGCGAATGCCGTGCTGGTGGCCAAGTCGGCCG
CCGAGGAGACGGAGACGGAGATACCCATGAGCCAGTTCTTTACTGGGTATCGCAAGACTGCTCTCCCTCAAGACG
CCATCATCGCATCTATCCGCATCCCGGTCACCGCCGAGAAGGGAGAGTTCTTCCGCGCATACAAACAGGCGAAGC
GCAAGGATGACGACATTGCCATCGTCACGGGCGCGTTGAGGGTCAAGCTGGACGGCGCGGGCGTCGTCACGCAAT
GCGCCTTAATCTACGGCGGGATGGCCGCCTTGACCGTGTCGGCCAAGACGGCCACCCAGTTCCTCGTCGGGAAGC
GCTTCGCCGAGCTCGAGACGCTTGAAGGAGCCATGAGCGCCTTGGGCGAGGACTTTGACATGCAATTCAGCGTTC
CTGGAGGCATGGCCTCGTATCGAAAGGCCCTCGCTCTCGGCTTCTTCTATCGCTTCTACCACGACGTGCTCACGA
ATCTGGACGGACGGTGCAAGCACGTTGATAAGGAGGCCATCGACGAGCTCGAACGCTCTATTTCCAAGGGTATGG
TGGACGAGAAGTCGTCCGTGGCGTACGAAAAGGAGGTGACGGGCAAAGCAAACCCCCACGTAGCCGCGCTCAAGC
AGACAACGGGAGAGGCCCAATACACCGATGATATCCCTTCTTTGAAGAACGAGTTGCACGGCTGCTGGGTCTTGT
CTACCAGGGCGCATGCGCGGATCAAATCGATCGATTACTCTGCGGCGCTCGACATGCCCGGCGTCGTCGATTACG
TCGACAGAAGCGACATGCCATCCGCCGAAGCCAACAAGTTCGGCGCTCCTCACTTCGACGAGGTCTTCTTCGCAG
AGGGGGAGGTCCACACGGCCGGCCAGCCGATCGCCATGGTTCTGGCCACGTCCGCCTCGAGGGCACAGGAGGCGG
CCCGAGCCGTCAAAATCGAGTACGAAAATCTTCCGGCGGTGCTCACGATGGAAGAGGCAATCGAACAGGACAGCT
TCCACCCTTTGTTCCGAGAAATCAAGCGGGGAGACGCCGAAAGGGCATTCAAGACTTGTGATCACGTCTTCACGG
GCACCGCCAGGATGGGCGGGCAGGAGCACTTCTACCTGGAGACCAATGCCTGCCTCGTCGTACCGAAGCCTGAGG
ATGGCGAGATGGAAATATTTGCCAGCACGCAAAACCCTAACGAGACGTGAGTGCCCGCGGCCATGCGCTTGCGCC
CCTAACATGACCAAACTGACCCCATCGCCATGCAGACAGGTGTTCGCGTCACGTGTGTGCGAAGTGGAAGCAAAC
AAGGTCGTCGTACGCGTCAAGAGGCTCGGCGGCGGCTTCGGCGGTAAGGAGACTCGATCGGTTCTCCTGAGCTCG
GCCGCGGCGCTGGCGGCGAGGAAGACGGGGCGGCCGATTCGGTGCATGCTTACGCGCGAGGAGGACATGATCACG
ATGGGCCAGAGGCATCCCTTCATGGCGCGGTACAAGGTCGGCGTCAACAAGGACGGCCGGATACAGGCGCTCGAC
CTCGACATCTTCAACAATGCCGGCTGGACGTTCGACCTGAGCGCCAGCGTGGTCGAGCGTGCCATGACGCATAGC
GACGGCTGTTACGACATCCCCCACGTGCACGTCCGCGGTCGCATCTGCAAGACCAATACCGTTTCCAATACGGCC
TTCCGCGGCTTCGGAGGTCCCCAGGGCATGTTCATCGCCGAGACATACATGGAAGAGACGGCAGACCGGCTGGGC
ATGCCCGTGGAGCGGCTGCGGGAGGTGAATTTCTACAAGCCGCGCGGCGTCACGCACTTCAACCAGACGCTCGAG
GACTGGCACGTCCCCCTGATGTACCAGCAAGTGCAGGACGAGTCGGGCTACGGCCAGCGGCGGGCCATGGTGGAC
GCGTTCAATGGCGACTACAAGTGGCGCAAGAGAGGGCTGGCCCTAATCCCGACCAAGTTCGGCATATCCTTCACG
GCCCTCTTCCTCAACCAGGCCGGCGCGCTGGTGCACATCTACCACGATGGCTCCATCCTGGTGGCGCATGGCGGC
ACGGAGATGGGCCAGGGCCTGCACACGAAGCTCTCGCAGATTGCGGCCCAGGCCCTGTCGGTGCCGCTCGAGAGC
GTCTTCATCTCGGAGACGGCGACGAACACGGTAGCCAACGCGTCGGCAACGGCGGCGTCGGCGTCGTCGGACCTG
AACGGCTACGCCATCTACAACGCCTGCCGACAGCTGAACGAGCGGCTGGCGCCGTACCGCGAGAAGCTGGGGCCC
GGGGCGACGATGAAGGCGCTCGCGCACGCGGCCTACTTTGACCGGGTCAACCTGTCGGCGCAGGGCTTCTACAAG
ACGCCGGACATTGGGTACGTGTGGGGCGAAAACAAGGGCAAGATGTTCTTCTACTTCACGCAGGGCGTCGCGGCG
GCCGAGGTCGAGGTGGACACGCTGACGGGGACGTGGACGTGCTTGCGGGCCGACATCAAGATGGACGTGGGCCAG
TCCATCAACCCGTCGATCGACTACGGGCAGATCCAGGGGGCCTTTGTGCAGGGCATGGGCCTCTTTACCATGGAG
GAGTCGCTGTGGCTCCGCAACGGGCCCATGGCCGGCAATCTGTTCACGCGCGGCCCCGGCGCGTACAAAATCCCC
GGCTTCCGCGACATTCCGCAGGAGTTCAACGTGAGGCTGCTCAAGGACGTGGAGTGGAAGGAGCTGCGGACGATC
CAGCGCAGCAGGGGCGTGGGCGAGCCGCCACTGTTTCTCGGCAGTGCCGTCTTCTTCGCCATCCGAGACGCGCTG
AGGGCGGCGAGGAGGGCGGCCGGGGTCGAGGTGACGGCGGGCGACGGCGGCGACGCAGGGCTGCTGAGGCTAGAG
AGCCCGGCGACGCCTGAGCGGATCAGGCTGGCATGTGAGGACGAGATTATGCGGCGCGCGCGGGTGGTGCCCAAG
GAAGGCGAGAAGAGCTTCTTCGTGGCCATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail