Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6499
Gene name
LocationContig_335:109..1934
Strand-
Gene length (bp)1825
Transcript length (bp)747
Coding sequence length (bp)747
Protein length (aa) 249

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 3.9E-06 84 112

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C5MCK5|GSM1_CANTT Glucose starvation modulator protein 1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=GSM1 PE=3 SV=1 66 211 1.0E-10
sp|C4R1K8|ERT1_PICPG Transcription activator of gluconeogenesis ERT1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ERT1 PE=3 SV=1 68 154 3.0E-10
sp|B9WLA7|ERT1_CANDC Transcription activator of gluconeogenesis ERT1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ERT1 PE=3 SV=1 78 157 7.0E-10
sp|A6R213|ACUK_AJECN Transcription activator of gluconeogenesis HCAG_03671 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_03671 PE=3 SV=1 35 134 1.0E-09
sp|C5PHH6|ACUK_COCP7 Transcription activator of gluconeogenesis CPC735_053490 OS=Coccidioides posadasii (strain C735) GN=CPC735_053490 PE=3 SV=1 78 134 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C5MCK5|GSM1_CANTT Glucose starvation modulator protein 1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=GSM1 PE=3 SV=1 66 211 1.0E-10
sp|C4R1K8|ERT1_PICPG Transcription activator of gluconeogenesis ERT1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ERT1 PE=3 SV=1 68 154 3.0E-10
sp|B9WLA7|ERT1_CANDC Transcription activator of gluconeogenesis ERT1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ERT1 PE=3 SV=1 78 157 7.0E-10
sp|A6R213|ACUK_AJECN Transcription activator of gluconeogenesis HCAG_03671 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_03671 PE=3 SV=1 35 134 1.0E-09
sp|C5PHH6|ACUK_COCP7 Transcription activator of gluconeogenesis CPC735_053490 OS=Coccidioides posadasii (strain C735) GN=CPC735_053490 PE=3 SV=1 78 134 1.0E-09
sp|P19541|RDS2_YEAST Regulator of drug sensitivity 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDS2 PE=1 SV=2 77 117 2.0E-09
sp|C5FP02|ACUK_ARTOC Transcription activator of gluconeogenesis MCYG_04674 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04674 PE=3 SV=1 78 136 2.0E-09
sp|C4JFE4|ACUK_UNCRE Transcription activator of gluconeogenesis UREG_00958 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_00958 PE=3 SV=2 78 134 2.0E-09
sp|A7TQK0|GSM1_VANPO Glucose starvation modulator protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=GSM1 PE=3 SV=1 68 128 3.0E-09
sp|D4AL61|ACUK_ARTBC Transcription activator of gluconeogenesis ARB_05058 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05058 PE=3 SV=1 78 136 3.0E-09
sp|D4D2Y6|ACUK_TRIVH Transcription activator of gluconeogenesis TRV_01442 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_01442 PE=3 SV=1 78 136 3.0E-09
sp|C5JT39|ACUK_AJEDS Transcription activator of gluconeogenesis BDBG_05438 OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_05438 PE=3 SV=1 60 134 4.0E-09
sp|C0NCM1|ACUK_AJECG Transcription activator of gluconeogenesis HCBG_00867 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_00867 PE=3 SV=1 67 134 4.0E-09
sp|C5GF27|ACUK_AJEDR Transcription activator of gluconeogenesis BDCG_02812 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_02812 PE=3 SV=1 60 134 4.0E-09
sp|C1GR85|ACUK_PARBA Transcription activator of gluconeogenesis PAAG_01030 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_01030 PE=3 SV=2 78 134 5.0E-09
sp|C1G966|ACUK_PARBD Transcription activator of gluconeogenesis PADG_03802 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_03802 PE=3 SV=2 78 134 6.0E-09
sp|Q6CKI5|ERT1_KLULA Transcription activator of gluconeogenesis ERT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERT1 PE=3 SV=1 75 132 6.0E-09
sp|E4UP58|ACUK_ARTGP Transcription activator of gluconeogenesis MGYG_02011 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02011 PE=3 SV=1 78 136 7.0E-09
sp|Q6C764|ERT12_YARLI Transcription activator of gluconeogenesis ERT1-2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERT1-2 PE=3 SV=1 78 127 8.0E-09
sp|Q6BY37|ERT1_DEBHA Transcription activator of gluconeogenesis ERT1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERT1 PE=3 SV=2 78 120 8.0E-09
sp|Q6FML7|ERT1_CANGA Transcription activator of gluconeogenesis ERT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERT1 PE=3 SV=1 77 132 9.0E-09
sp|Q7RUA4|ACUK_NEUCR Transcription activator of gluconeogenesis NCU03938 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=G17A4.270 PE=3 SV=2 19 141 1.0E-08
sp|D1ZRZ5|ACUK_SORMK Transcription activator of gluconeogenesis SMAC_06113 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_06113 PE=3 SV=2 29 141 1.0E-08
sp|B9W8A8|GSM1_CANDC Glucose starvation modulator protein 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=GSM1 PE=3 SV=1 66 178 2.0E-08
sp|Q59WB9|GSM1_CANAL Glucose starvation modulator protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ZCF23 PE=3 SV=1 66 134 2.0E-08
sp|C4Y4V1|GSM1_CLAL4 Glucose starvation modulator protein 1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=GSM1 PE=3 SV=1 66 137 3.0E-08
sp|Q754V2|ERT1_ASHGO Transcription activator of gluconeogenesis ERT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERT1 PE=3 SV=2 78 120 3.0E-08
sp|C4YDV1|GSM1_CANAW Glucose starvation modulator protein 1 OS=Candida albicans (strain WO-1) GN=GSM1 PE=3 SV=1 66 134 4.0E-08
sp|C4YLC3|ERT1_CANAW Transcription activator of gluconeogenesis ERT1 OS=Candida albicans (strain WO-1) GN=ERT1 PE=3 SV=1 78 120 4.0E-08
sp|A8N767|ERT1_COPC7 Transcription activator of gluconeogenesis ERT1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ERT1 PE=3 SV=1 69 127 5.0E-08
sp|Q6BJW8|GSM1_DEBHA Glucose starvation modulator protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GSM1 PE=3 SV=2 66 132 8.0E-08
sp|A3LQV7|ERT1_PICST Transcription activator of gluconeogenesis ERT1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ERT1 PE=3 SV=2 78 120 9.0E-08
sp|D8Q8R5|ERT1_SCHCM Transcription activator of gluconeogenesis ERT1 OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=ERT1 PE=3 SV=1 78 116 9.0E-08
sp|A7EAG1|ACUK_SCLS1 Transcription activator of gluconeogenesis SS1G_02293 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_02293 PE=3 SV=1 27 172 1.0E-07
sp|Q4PD88|ERT1_USTMA Transcription activator of gluconeogenesis ERT1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERT1 PE=3 SV=2 78 120 1.0E-07
sp|Q6CK33|GSM1_KLULA Glucose starvation modulator protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GSM1 PE=3 SV=1 68 139 2.0E-07
sp|C4QV17|GSM1_PICPG Glucose starvation modulator protein 1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=GSM1 PE=3 SV=1 68 119 3.0E-07
sp|Q4WHD1|ACUK_ASPFU Transcription activator of gluconeogenesis acuK OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acuK PE=3 SV=2 86 151 3.0E-07
sp|B0XVV1|ACUK_ASPFC Transcription activator of gluconeogenesis acuK OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=acuK PE=3 SV=2 86 151 3.0E-07
sp|Q754J3|GSM1_ASHGO Glucose starvation modulator protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GSM1 PE=3 SV=1 68 131 3.0E-07
sp|C7GR11|GSM1_YEAS2 Glucose starvation modulator protein 1 OS=Saccharomyces cerevisiae (strain JAY291) GN=GSM1 PE=3 SV=1 68 114 3.0E-07
sp|A1DG01|ACUK_NEOFI Transcription activator of gluconeogenesis acuK OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=acuK PE=3 SV=1 86 192 3.0E-07
sp|A5DF43|ERT1_PICGU Transcription activator of gluconeogenesis ERT1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ERT1 PE=3 SV=2 77 120 3.0E-07
sp|C8ZBB1|GSM1_YEAS8 Glucose starvation modulator protein 1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=GSM1 PE=3 SV=2 68 114 3.0E-07
sp|B3LQ10|GSM1_YEAS1 Glucose starvation modulator protein 1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=GSM1 PE=3 SV=1 68 114 3.0E-07
sp|A6ZQM3|GSM1_YEAS7 Glucose starvation modulator protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=GSM1 PE=3 SV=1 68 114 3.0E-07
sp|P42950|GSM1_YEAST Glucose starvation modulator protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSM1 PE=1 SV=1 68 114 3.0E-07
sp|A1C602|ACUK_ASPCL Transcription activator of gluconeogenesis acuK OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=acuK PE=3 SV=1 86 190 4.0E-07
sp|A5DU46|GSM1_LODEL Glucose starvation modulator protein 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=GSM1 PE=3 SV=1 66 131 4.0E-07
sp|B6Q3B6|ACUK_TALMQ Transcription activator of gluconeogenesis PMAA_028970 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_028970 PE=3 SV=1 43 129 5.0E-07
sp|B6HSQ3|ACUK_PENRW Transcription activator of gluconeogenesis Pc22g08580 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc22g08580 PE=3 SV=1 26 129 5.0E-07
sp|C7YM38|ACUK_NECH7 Transcription activator of gluconeogenesis NECHADRAFT_59099 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_59099 PE=3 SV=1 27 202 6.0E-07
sp|Q2GSA4|ACUK_CHAGB Transcription activator of gluconeogenesis CHGG_09150 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_09150 PE=3 SV=1 86 152 7.0E-07
sp|B8PBQ6|ERT1_POSPM Transcription activator of gluconeogenesis ERT1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=ERT1 PE=3 SV=1 78 133 8.0E-07
sp|Q2UMM2|ACUK_ASPOR Transcription activator of gluconeogenesis acuK OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=acuK PE=3 SV=1 86 129 8.0E-07
sp|B0D0T8|ERT1_LACBS Transcription activator of gluconeogenesis ERT1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=ERT1 PE=3 SV=1 78 116 9.0E-07
sp|A2QFG8|ACUK_ASPNC Transcription activator of gluconeogenesis acuK OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=acuK PE=3 SV=1 86 129 1.0E-06
sp|C5E2K7|ERT1_LACTC Transcription activator of gluconeogenesis ERT1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=ERT1 PE=3 SV=1 78 120 1.0E-06
sp|Q5AW62|ACUK_EMENI Transcription activator of gluconeogenesis acuK OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acuK PE=3 SV=1 86 129 1.0E-06
sp|A6SP81|ACUK_BOTFB Transcription activator of gluconeogenesis BC1G_14637 OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_14637 PE=3 SV=1 27 140 1.0E-06
sp|B8LT44|ACUK_TALSN Transcription activator of gluconeogenesis TSTA_069700 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_069700 PE=3 SV=1 86 129 1.0E-06
sp|Q6C5G3|ERT11_YARLI Transcription activator of gluconeogenesis ERT1-1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERT1-1 PE=3 SV=1 85 126 3.0E-06
sp|A3LWY2|GSM1_PICST Glucose starvation modulator protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=GSM1 PE=3 SV=2 77 120 3.0E-06
sp|C5E1J9|ERT1_ZYGRC Transcription activator of gluconeogenesis OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ERT1 PE=3 SV=1 72 132 3.0E-06
sp|Q6FLG1|GSM1_CANGA Glucose starvation modulator protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GSM1 PE=3 SV=1 85 124 4.0E-06
sp|Q0U7C8|ACUK_PHANO Transcription activator of gluconeogenesis SNOG_12336 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_12336 PE=3 SV=2 86 151 5.0E-06
sp|B2AR36|ACUK_PODAN Transcription activator of gluconeogenesis PODANS_4_8760 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_4_8760 PE=3 SV=1 24 141 5.0E-06
sp|B2W978|ACUK_PYRTR Transcription activator of gluconeogenesis PTRG_06536 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_06536 PE=3 SV=1 33 194 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0008270 zinc ion binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0005634 nucleus Yes
GO:0043169 cation binding No
GO:0065007 biological regulation No
GO:0010468 regulation of gene expression No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0005488 binding No
GO:0046872 metal ion binding No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0060255 regulation of macromolecule metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:2001141 regulation of RNA biosynthetic process No
GO:0043167 ion binding No
GO:0044424 intracellular part No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0050789 regulation of biological process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0044464 cell part No
GO:0031323 regulation of cellular metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0003700 DNA-binding transcription factor activity No
GO:0046914 transition metal ion binding No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6499
MSDGRAKAAATASDAAGHPAVDGANGDVADAKRDDDAAEGETADKDDDDDGDSAAAAAAGGGEGGLTTQAKPAKS
PKKRRKVNHACVYCRRSHMTCDLERPCTRCIKRNIGHLCHDEPREADAKKLKNAKGVAVTAVDEPDPSDAGRNPM
PSAMGPPPAFDGPRQQPSSGAGYGAAGVLGQANPLSLVQQPPAATGLQADGLNNNSASGNANQMAGFSDAWLTAQ
SFSDVSSYNPNYMIASHPEQRGL*
Coding >Hirsu2|6499
ATGAGCGACGGGAGAGCCAAGGCCGCTGCCACGGCCAGCGACGCCGCCGGCCACCCGGCGGTCGACGGCGCAAAC
GGCGATGTGGCCGACGCCAAGCGCGACGACGACGCTGCTGAGGGCGAGACGGCCGACAAGGACGACGACGATGAC
GGCGACAGCGCAGCAGCAGCAGCAGCAGGAGGAGGAGAGGGGGGCTTGACGACGCAGGCCAAGCCGGCCAAAAGC
CCCAAGAAGAGGCGCAAAGTCAACCACGCCTGTGTATATTGCAGGAGATCTCATATGACATGCGATCTAGAGCGA
CCGTGCACGAGGTGTATCAAGCGCAACATCGGCCACCTCTGCCACGATGAGCCGCGCGAGGCGGACGCGAAGAAG
CTCAAGAACGCCAAGGGCGTGGCGGTCACGGCCGTGGACGAGCCGGACCCGTCCGACGCCGGCCGCAACCCGATG
CCCAGCGCCATGGGGCCGCCGCCAGCCTTCGACGGCCCGAGGCAGCAGCCGTCGTCGGGTGCTGGCTACGGAGCC
GCTGGCGTGCTGGGCCAGGCAAACCCGCTCTCGCTCGTGCAACAGCCGCCCGCCGCGACGGGCCTGCAGGCCGAC
GGCCTGAACAACAACAGTGCGAGCGGCAACGCGAATCAAATGGCCGGCTTCTCGGACGCCTGGTTGACGGCGCAG
AGCTTCAGCGACGTGAGCAGCTACAACCCCAACTACATGATCGCCTCGCACCCAGAACAACGCGGCCTTTAG
Transcript >Hirsu2|6499
ATGAGCGACGGGAGAGCCAAGGCCGCTGCCACGGCCAGCGACGCCGCCGGCCACCCGGCGGTCGACGGCGCAAAC
GGCGATGTGGCCGACGCCAAGCGCGACGACGACGCTGCTGAGGGCGAGACGGCCGACAAGGACGACGACGATGAC
GGCGACAGCGCAGCAGCAGCAGCAGCAGGAGGAGGAGAGGGGGGCTTGACGACGCAGGCCAAGCCGGCCAAAAGC
CCCAAGAAGAGGCGCAAAGTCAACCACGCCTGTGTATATTGCAGGAGATCTCATATGACATGCGATCTAGAGCGA
CCGTGCACGAGGTGTATCAAGCGCAACATCGGCCACCTCTGCCACGATGAGCCGCGCGAGGCGGACGCGAAGAAG
CTCAAGAACGCCAAGGGCGTGGCGGTCACGGCCGTGGACGAGCCGGACCCGTCCGACGCCGGCCGCAACCCGATG
CCCAGCGCCATGGGGCCGCCGCCAGCCTTCGACGGCCCGAGGCAGCAGCCGTCGTCGGGTGCTGGCTACGGAGCC
GCTGGCGTGCTGGGCCAGGCAAACCCGCTCTCGCTCGTGCAACAGCCGCCCGCCGCGACGGGCCTGCAGGCCGAC
GGCCTGAACAACAACAGTGCGAGCGGCAACGCGAATCAAATGGCCGGCTTCTCGGACGCCTGGTTGACGGCGCAG
AGCTTCAGCGACGTGAGCAGCTACAACCCCAACTACATGATCGCCTCGCACCCAGAACAACGCGGCCTTTAG
Gene >Hirsu2|6499
ATGAGCGACGGGAGAGCCAAGGCCGCTGCCACGGCCAGCGACGCCGCCGGCCACCCGGCGGTCGACGGCGCAAAC
GGCGATGTGGCCGACGCCAAGCGCGACGACGACGCTGCTGAGGGCGAGACGGCCGACAAGGACGACGACGATGAC
GGCGACAGCGCAGCAGCAGCAGCAGCAGGAGGAGGAGAGGGGGGCTTGACGACGCAGGCCAAGCCGGCCAAAAGC
CCCAAGAAGAGGCGCAAAGTCAACCACGGTACGCACCATCTCTCCCCGATCCCCGCCAGCCTCGACGCCCATCTT
CTCTTGCCCTTCATGGCCGAGGACGGAGGAGGGGGGACCGAGGCATGGAACGAGCGAGAGGGAGACGGCGAGCCA
TGAGCGAAAGGGGGCTTCAGGGGGCAGCGGACGCCCGCAGCTGACCCTTGCCCTGCCTCTCTTCCGCCCTCCTCG
CCCTCCCCCCTTCTCTCTCGTTGCCCCCTTTTCGGCCTTGTCCGCTTCACCTGACGCTGTTCGTGGATCGTGCGC
TAATGTCGGCGGCGGCTGCCTGCGTTTTGCGCCTTGCCCGGCCTCTCTCTCGCGCGCGCGCCCACATCTCCAGCC
TGTGTATATTGCAGGAGATCTGTGAGTCTACCCGACGGCCATGACACACAGGCACCCATGCAGGCACCCACGGTC
ATGAGGCGGGGGTGGAAGAATAGGGGGGGGGAGGCCGCGCTCGGCCGACGGCTGCAATGACCCAAGAGCCCTCGG
AGGAGGGGAAAAGGGGGGAGGGGAGGGAGAAGGCGGACGGAGGAGGATTGGGGGGCGGGGACGGGGGGGCGGAGG
GCGTGAGGACAATCAAGATGGCTTCCCGCTGGCCTCACCCCGAGCTGTTTGGATGCACGTGGCTGACAAGTTCTC
GTCTTTGTGCGCTCTACAGCATATGACATGCGATCTAGTACGTGTTCTCTGAGGCGACGCCCGCCGTCGTGCCAT
CTGCAGACTGCAATGCCCGCCGCGCCCCGAGGCTGCTCATTCGCCTCGCCCTCATCCCCCTCCCCCTCCCCCCTT
TTGGCGACGGGCTGACCAGCTGTCCAGGAGCGACCGTGCACGAGGTGTATCAAGCGCAACATCGGCCACCTCTGC
CACGATGAGCCGCGCGAGGCGGACGCGAAGAAGCTCAAGAACGCCAAGGGCGTGGCGGTCACGGCCGTGGACGAG
CCGGACCCGTCCGACGCCGGCCGCAACCCGATGCCCAGCGCCATGGGGCCGCCGCCAGCCTTCGACGGCCCGAGG
CAGCAGCCGTCGTCGGGTGCTGGCTACGGAGCCGCTGGCGTGCTGGGCCAGGCAAACCCGCTCTCGCTCGTGCAA
CAGCCGCCCGCCGCGACGGGCCTGCAGGCCGACGGCCTGAACAACAACAGTGCGAGCGGCAACGCGAATCAAAGT
ACGTCTTCCGTCTTTCTCTCTCTCCATCTCGCCGTGTGCGCCTGCCTCTCTGCGTCTCATGGGCGGATGAGCCAC
GCATCTCTTCTTCCCGCCGTCCCCCCTCCCCCCCCTTTCTTGTCCCCCCCATCGTGTCAGACGCAGACGGGATGC
CTCGGTACATCTGGCTGGTCGACGTCGGCGTCGTGGCATCGAGGGCTAATCGGCCTGCTGCAGTGGCCGGCTTCT
CGGACGCCTGGTTGACGGCGCAGAGCTTCAGCGACGTGAGCAGCTACAACCCCAACTACATGATCGCCTCGCACG
TCTCGCACGAGTTCAACCTGCTCAACGACTTCCTCCACGGCGGATACCTGGACGCGGCCGGCCTGGCGCCCGACG
ACAGCCAGAACAACGCGGCCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail