Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6497
Gene name
LocationContig_3343:236..602
Strand-
Gene length (bp)366
Transcript length (bp)243
Coding sequence length (bp)243
Protein length (aa) 81

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16113 ECH_2 Enoyl-CoA hydratase/isomerase 1.0E-08 21 76
PF00378 ECH_1 Enoyl-CoA hydratase/isomerase 4.1E-07 18 75

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003860 3-hydroxyisobutyryl-CoA hydrolase activity Yes
GO:0003824 catalytic activity Yes
GO:0016289 CoA hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016790 thiolester hydrolase activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6497
MAAAPPAASSAVRLEYRGRVAVLTLANERKLNALSRDQYYELARRMQEVAARDDVVVTVLLGEGRYFSAGADVTA
ARPPP*
Coding >Hirsu2|6497
ATGGCGGCGGCACCACCCGCGGCCTCGTCGGCGGTGCGGCTCGAGTACCGCGGGCGCGTGGCGGTGCTGACGCTG
GCCAACGAGCGCAAGCTCAACGCGCTGAGCCGCGACCAGTACTATGAGCTGGCGCGGCGGATGCAGGAGGTGGCG
GCGCGCGATGACGTCGTCGTGACGGTGCTGCTGGGCGAGGGGCGCTACTTTTCCGCCGGCGCCGACGTCACGGCC
GCGCGCCCGCCGCCCTGA
Transcript >Hirsu2|6497
ATGGCGGCGGCACCACCCGCGGCCTCGTCGGCGGTGCGGCTCGAGTACCGCGGGCGCGTGGCGGTGCTGACGCTG
GCCAACGAGCGCAAGCTCAACGCGCTGAGCCGCGACCAGTACTATGAGCTGGCGCGGCGGATGCAGGAGGTGGCG
GCGCGCGATGACGTCGTCGTGACGGTGCTGCTGGGCGAGGGGCGCTACTTTTCCGCCGGCGCCGACGTCACGGCC
GCGCGCCCGCCGCCCTGA
Gene >Hirsu2|6497
ATGGCGGCGGCACCACCCGCGGCCTCGTCGGCGGTGCGGCTCGAGTACCGCGGGCGCGTGGCGGTGCTGACGCTG
GCCAACGAGCGCAAGCTCAACGCGCTGAGCCGCGACCAGTACTATGAGCTGGCGCGGCGGATGCAGGAGGTGGCG
GCGCGCGATGACGTCGTCGTGACGGTGCTGCTGGGCGAGGGGCGCTACTTTTCCGCGTACGTCTGCTGCCTCCTT
CTCTCGCCTCCTTGCTTCCTGGCTGACGCCTCTCCGACAGCGGCGCCGACGTCACGGCCGCGCGCCCGCCGCCGT
CGCCCGCCGCGGACGAGCTGCACCGCCACTACCTGACCAGCTTCGTGGCCGTCAACCTGCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail