Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6484
Gene name
LocationContig_3337:50..755
Strand-
Gene length (bp)705
Transcript length (bp)534
Coding sequence length (bp)534
Protein length (aa) 178

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00230 MIP Major intrinsic protein 6.5E-11 39 143

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P29975|AQP1_RAT Aquaporin-1 OS=Rattus norvegicus GN=Aqp1 PE=1 SV=4 31 177 7.0E-07
sp|Q02013|AQP1_MOUSE Aquaporin-1 OS=Mus musculus GN=Aqp1 PE=1 SV=3 31 139 4.0E-06
sp|P25794|PIP2_PEA Probable aquaporin PIP-type 7a OS=Pisum sativum GN=TRG-31 PE=2 SV=2 19 145 6.0E-06

GO

GO Term Description Terminal node
GO:0015267 channel activity Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022803 passive transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22
2 73 95 22
3 118 140 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6484
MNESTAEAVSAASISSWPPSMAPSFQTPDRASLVPFRGVWRAAFVEAVAMTCFIFATGQITATLSSYDTKQQGAY
SGIGTCVISSLSIYAIGAATGGQINPMITFSAVLAGLCPVSRGVLYMCGQTIGAALASGILTGVWGRERLIRYPS
TSFLEFRNTSLILQGFMEVAASSTRRR*
Coding >Hirsu2|6484
ATGAACGAAAGCACTGCCGAGGCGGTGTCCGCGGCAAGCATCTCCAGCTGGCCTCCTTCGATGGCTCCTTCGTTC
CAGACGCCAGACCGGGCCTCGCTCGTGCCGTTCCGTGGCGTTTGGCGGGCAGCCTTTGTCGAGGCCGTGGCCATG
ACCTGTTTCATCTTCGCCACTGGACAGATAACTGCCACGCTGAGCAGCTATGATACTAAGCAGCAGGGGGCCTAT
AGCGGCATAGGCACATGTGTTATATCTTCCTTGTCTATCTACGCCATAGGTGCAGCCACGGGCGGCCAAATCAAC
CCCATGATTACCTTCTCCGCCGTCCTCGCGGGACTCTGCCCGGTCTCAAGAGGCGTGCTATACATGTGCGGCCAG
ACAATCGGTGCTGCACTGGCCAGTGGGATTTTAACTGGCGTCTGGGGTCGCGAGCGATTAATCAGGTATCCCAGC
ACCAGCTTCCTAGAGTTTCGGAATACATCGCTAATTCTTCAAGGATTCATGGAGGTGGCTGCTTCTTCGACTCGT
CGCAGATGA
Transcript >Hirsu2|6484
ATGAACGAAAGCACTGCCGAGGCGGTGTCCGCGGCAAGCATCTCCAGCTGGCCTCCTTCGATGGCTCCTTCGTTC
CAGACGCCAGACCGGGCCTCGCTCGTGCCGTTCCGTGGCGTTTGGCGGGCAGCCTTTGTCGAGGCCGTGGCCATG
ACCTGTTTCATCTTCGCCACTGGACAGATAACTGCCACGCTGAGCAGCTATGATACTAAGCAGCAGGGGGCCTAT
AGCGGCATAGGCACATGTGTTATATCTTCCTTGTCTATCTACGCCATAGGTGCAGCCACGGGCGGCCAAATCAAC
CCCATGATTACCTTCTCCGCCGTCCTCGCGGGACTCTGCCCGGTCTCAAGAGGCGTGCTATACATGTGCGGCCAG
ACAATCGGTGCTGCACTGGCCAGTGGGATTTTAACTGGCGTCTGGGGTCGCGAGCGATTAATCAGGTATCCCAGC
ACCAGCTTCCTAGAGTTTCGGAATACATCGCTAATTCTTCAAGGATTCATGGAGGTGGCTGCTTCTTCGACTCGT
CGCAGATGA
Gene >Hirsu2|6484
ATGAACGAAAGCACTGCCGAGGCGGTGTCCGCGGCAAGCATCTCCAGCTGGCCTCCTTCGATGGCTCCTTCGTTC
CAGACGCCAGACCGGGCCTCGCTCGTGCCGTTCCGTGGTACAGAGACCGCGACTATCTCCTGAGCGGCTGGCTGA
GACCAGGCGTTTGGCGGGCAGCCGTAGGTGTCGCGATCCTGCCATGCGTATTCTCGAAGTCCTTGCTTACACGTG
GCGCGAATCGCGAAACATAGTTTGTCGAGGCCGTGGCCATGACCTGTTTCATCTTCGCCACTGGACAGATAACTG
CCACGCTGAGCAGCTATGATACTAAGCAGCAGGGGGCCTATAGCGGCATAGGCACATGTGTTATATCTTCCTTGT
CTATCTACGCCATAGGTGCAGCCACGGGCGGCCAAATCAACCCCATGATTACCTTCTCCGCCGTCCTCGCGGGAC
TCTGCCCGGTCTCAAGAGGTCTGTTCGCGATTTTGTGTCCTCCATTAGCCGGCGACGGCTGACCACGGTCAAGGC
GTGCTATACATGTGCGGCCAGACAATCGGTGCTGCACTGGCCAGTGGGATTTTAACTGGCGTCTGGGGTCGCGAG
CGATTAATCAGGTATCCCAGCACCAGCTTCCTAGAGTTTCGGAATACATCGCTAATTCTTCAAGGATTCATGGAG
GTGGCTGCTTCTTCGACTCGTCGCAGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail