Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6481
Gene name
LocationContig_3331:256..976
Strand-
Gene length (bp)720
Transcript length (bp)720
Coding sequence length (bp)720
Protein length (aa) 240

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 7.6E-07 6 182

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36035|JEN1_YEAST Carboxylic acid transporter protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JEN1 PE=1 SV=1 1 239 2.0E-40

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 59 78 19
3 161 183 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6481
MAGFNFMSHGSQDLYPTMLESQLGFGPTRVTLTQVVSNLGAMLGGTLVGFGSQSVGRRLSILVCCVAGGALLYPY
TFVGSDAVMAAAFFQQFCVQGAWGVVPVHLMELSPGAFRTFVVGTSYQLGNLASSASSTIEARLGEQFPLPAPPG
GEAAAGERFEYGKVICIFMACVYAYVIALTLLGPEHLHRKLGVAHDADARAAVGSDAVDQAAARPELRGLDLDDA
DEEKKMTSAKTVEG*
Coding >Hirsu2|6481
ATGGCCGGCTTCAACTTCATGAGCCACGGCAGCCAGGACCTGTACCCGACCATGCTGGAGAGCCAGCTGGGCTTC
GGCCCGACGCGCGTGACGCTGACGCAGGTCGTCTCCAACCTGGGCGCCATGCTGGGCGGCACCCTCGTCGGCTTC
GGCAGCCAGTCGGTCGGGCGCCGGCTCAGCATCCTGGTCTGCTGCGTCGCCGGCGGCGCCCTGCTGTACCCCTAC
ACCTTCGTCGGCTCCGACGCCGTCATGGCCGCCGCCTTCTTCCAGCAGTTCTGCGTCCAGGGCGCCTGGGGCGTC
GTGCCCGTCCACCTGATGGAGCTGTCGCCGGGCGCCTTCCGCACCTTCGTCGTCGGCACCTCGTACCAGCTCGGC
AACCTGGCCTCGTCCGCCTCGTCCACCATCGAGGCCCGCCTCGGCGAGCAGTTCCCGCTGCCGGCCCCGCCCGGC
GGGGAGGCCGCCGCCGGCGAGCGCTTCGAGTACGGCAAGGTCATCTGCATCTTCATGGCCTGCGTCTACGCCTAC
GTCATCGCCCTGACCCTCCTCGGGCCCGAGCACCTGCACCGCAAGCTCGGCGTCGCCCACGACGCCGACGCCCGC
GCCGCCGTCGGCTCCGACGCCGTCGACCAAGCCGCCGCCCGCCCCGAGCTGCGCGGCCTGGACCTCGACGACGCC
GACGAGGAGAAGAAGATGACGTCGGCCAAGACGGTCGAGGGATGA
Transcript >Hirsu2|6481
ATGGCCGGCTTCAACTTCATGAGCCACGGCAGCCAGGACCTGTACCCGACCATGCTGGAGAGCCAGCTGGGCTTC
GGCCCGACGCGCGTGACGCTGACGCAGGTCGTCTCCAACCTGGGCGCCATGCTGGGCGGCACCCTCGTCGGCTTC
GGCAGCCAGTCGGTCGGGCGCCGGCTCAGCATCCTGGTCTGCTGCGTCGCCGGCGGCGCCCTGCTGTACCCCTAC
ACCTTCGTCGGCTCCGACGCCGTCATGGCCGCCGCCTTCTTCCAGCAGTTCTGCGTCCAGGGCGCCTGGGGCGTC
GTGCCCGTCCACCTGATGGAGCTGTCGCCGGGCGCCTTCCGCACCTTCGTCGTCGGCACCTCGTACCAGCTCGGC
AACCTGGCCTCGTCCGCCTCGTCCACCATCGAGGCCCGCCTCGGCGAGCAGTTCCCGCTGCCGGCCCCGCCCGGC
GGGGAGGCCGCCGCCGGCGAGCGCTTCGAGTACGGCAAGGTCATCTGCATCTTCATGGCCTGCGTCTACGCCTAC
GTCATCGCCCTGACCCTCCTCGGGCCCGAGCACCTGCACCGCAAGCTCGGCGTCGCCCACGACGCCGACGCCCGC
GCCGCCGTCGGCTCCGACGCCGTCGACCAAGCCGCCGCCCGCCCCGAGCTGCGCGGCCTGGACCTCGACGACGCC
GACGAGGAGAAGAAGATGACGTCGGCCAAGACGGTCGAGGGATGA
Gene >Hirsu2|6481
ATGGCCGGCTTCAACTTCATGAGCCACGGCAGCCAGGACCTGTACCCGACCATGCTGGAGAGCCAGCTGGGCTTC
GGCCCGACGCGCGTGACGCTGACGCAGGTCGTCTCCAACCTGGGCGCCATGCTGGGCGGCACCCTCGTCGGCTTC
GGCAGCCAGTCGGTCGGGCGCCGGCTCAGCATCCTGGTCTGCTGCGTCGCCGGCGGCGCCCTGCTGTACCCCTAC
ACCTTCGTCGGCTCCGACGCCGTCATGGCCGCCGCCTTCTTCCAGCAGTTCTGCGTCCAGGGCGCCTGGGGCGTC
GTGCCCGTCCACCTGATGGAGCTGTCGCCGGGCGCCTTCCGCACCTTCGTCGTCGGCACCTCGTACCAGCTCGGC
AACCTGGCCTCGTCCGCCTCGTCCACCATCGAGGCCCGCCTCGGCGAGCAGTTCCCGCTGCCGGCCCCGCCCGGC
GGGGAGGCCGCCGCCGGCGAGCGCTTCGAGTACGGCAAGGTCATCTGCATCTTCATGGCCTGCGTCTACGCCTAC
GTCATCGCCCTGACCCTCCTCGGGCCCGAGCACCTGCACCGCAAGCTCGGCGTCGCCCACGACGCCGACGCCCGC
GCCGCCGTCGGCTCCGACGCCGTCGACCAAGCCGCCGCCCGCCCCGAGCTGCGCGGCCTGGACCTCGACGACGCC
GACGAGGAGAAGAAGATGACGTCGGCCAAGACGGTCGAGGGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail