Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6474
Gene name
LocationContig_333:5960..7523
Strand+
Gene length (bp)1563
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 362 384 22
2 404 426 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6474
MSWTSDHEYRAFSTAAPRRDLSLAPAGQWSLDIWDVTDENPEGRWHVETSPDCLRDKAQLRIVFAPFKTPRQSSS
AQILELFRILRIPRDVLRPACHNFGSRLDAHGHCSWFQHLFKNIHVRQDPGKLPEVDNRAASPGHPLSTLPQADY
SWIKSCFFLRRYEDGSTILVCFAAPPQVARRIDLFTDTGSWGDVQANPYVLFDMVLEGLFLQVDEMVWNMAAVCG
PLEHSILELAHTQDFAKLNSQLSFAALHNCAKHIIHLTEGLEGCVMVVDAVLLNCDGASGDLGRQDSFPLTDVNS
RVHVQQQLRECLRHRRFLFRSTQLRLSSLQKRTDNTITLAFNVVTQKDSMEMTRDSRVMKTIAAITIVFLPTTGV
ASVVGSQLLTSNWHDDSKTWTIMATPLFWLTWWIAIPLTVCVVVLALTWQWWVNADRPQVRGRLLLQRPVEWANL
LRQRK*
Coding >Hirsu2|6474
ATGTCTTGGACCAGTGACCACGAATATCGAGCCTTCAGCACGGCCGCGCCTCGTCGCGACCTGTCGCTCGCTCCT
GCAGGACAATGGTCGCTCGACATCTGGGACGTGACCGACGAGAATCCGGAGGGCAGATGGCATGTGGAGACGAGC
CCCGACTGTCTTCGCGACAAGGCGCAGCTGCGTATAGTCTTCGCCCCGTTCAAGACGCCCCGACAGAGCTCCTCA
GCGCAGATCTTGGAGCTCTTCCGCATCCTGCGCATCCCCAGAGATGTCCTACGTCCGGCGTGCCACAACTTCGGC
AGCCGACTGGACGCCCACGGCCACTGCTCCTGGTTCCAGCACCTATTCAAGAACATACACGTCAGGCAGGATCCT
GGCAAGCTTCCCGAGGTCGATAATAGAGCCGCCAGCCCCGGTCACCCGCTTTCCACGCTTCCGCAGGCCGACTAC
AGCTGGATCAAGTCCTGCTTCTTCCTACGAAGATATGAGGACGGTAGCACCATTCTCGTCTGCTTTGCGGCGCCG
CCTCAAGTGGCCCGTAGGATCGACCTCTTTACCGATACCGGAAGTTGGGGTGACGTCCAAGCCAACCCCTACGTC
CTCTTCGACATGGTGCTGGAGGGCTTGTTCCTCCAGGTCGATGAGATGGTTTGGAACATGGCCGCGGTCTGCGGT
CCGCTAGAACACTCTATTCTCGAGCTGGCACACACCCAAGATTTCGCCAAGCTCAACTCCCAGCTCTCCTTTGCC
GCCCTACACAACTGTGCAAAGCACATCATTCATCTAACAGAGGGACTTGAAGGCTGTGTCATGGTTGTCGATGCC
GTCTTACTCAATTGCGACGGAGCCTCGGGTGACCTGGGCCGTCAAGACTCATTCCCCCTTACCGACGTGAATTCG
CGTGTCCACGTTCAGCAACAGCTGCGCGAGTGCCTGCGACATCGACGCTTCCTCTTCCGCTCGACGCAGCTCCGC
TTGTCAAGCCTGCAGAAGCGGACAGATAATACTATTACGCTGGCCTTCAATGTCGTGACGCAGAAGGACTCGATG
GAGATGACGCGCGATTCTAGAGTCATGAAAACGATCGCGGCTATCACTATCGTCTTCCTTCCCACAACGGGCGTG
GCCAGCGTGGTGGGATCGCAGTTGCTGACGTCCAACTGGCATGACGACTCCAAGACGTGGACCATCATGGCCACC
CCTCTGTTCTGGTTGACCTGGTGGATAGCGATCCCGTTGACCGTATGCGTCGTCGTGCTGGCGCTGACCTGGCAG
TGGTGGGTGAATGCCGATCGGCCACAGGTCAGAGGTCGACTGCTGTTGCAGAGGCCAGTCGAGTGGGCGAATCTG
CTACGACAGAGAAAGTGA
Transcript >Hirsu2|6474
ATGTCTTGGACCAGTGACCACGAATATCGAGCCTTCAGCACGGCCGCGCCTCGTCGCGACCTGTCGCTCGCTCCT
GCAGGACAATGGTCGCTCGACATCTGGGACGTGACCGACGAGAATCCGGAGGGCAGATGGCATGTGGAGACGAGC
CCCGACTGTCTTCGCGACAAGGCGCAGCTGCGTATAGTCTTCGCCCCGTTCAAGACGCCCCGACAGAGCTCCTCA
GCGCAGATCTTGGAGCTCTTCCGCATCCTGCGCATCCCCAGAGATGTCCTACGTCCGGCGTGCCACAACTTCGGC
AGCCGACTGGACGCCCACGGCCACTGCTCCTGGTTCCAGCACCTATTCAAGAACATACACGTCAGGCAGGATCCT
GGCAAGCTTCCCGAGGTCGATAATAGAGCCGCCAGCCCCGGTCACCCGCTTTCCACGCTTCCGCAGGCCGACTAC
AGCTGGATCAAGTCCTGCTTCTTCCTACGAAGATATGAGGACGGTAGCACCATTCTCGTCTGCTTTGCGGCGCCG
CCTCAAGTGGCCCGTAGGATCGACCTCTTTACCGATACCGGAAGTTGGGGTGACGTCCAAGCCAACCCCTACGTC
CTCTTCGACATGGTGCTGGAGGGCTTGTTCCTCCAGGTCGATGAGATGGTTTGGAACATGGCCGCGGTCTGCGGT
CCGCTAGAACACTCTATTCTCGAGCTGGCACACACCCAAGATTTCGCCAAGCTCAACTCCCAGCTCTCCTTTGCC
GCCCTACACAACTGTGCAAAGCACATCATTCATCTAACAGAGGGACTTGAAGGCTGTGTCATGGTTGTCGATGCC
GTCTTACTCAATTGCGACGGAGCCTCGGGTGACCTGGGCCGTCAAGACTCATTCCCCCTTACCGACGTGAATTCG
CGTGTCCACGTTCAGCAACAGCTGCGCGAGTGCCTGCGACATCGACGCTTCCTCTTCCGCTCGACGCAGCTCCGC
TTGTCAAGCCTGCAGAAGCGGACAGATAATACTATTACGCTGGCCTTCAATGTCGTGACGCAGAAGGACTCGATG
GAGATGACGCGCGATTCTAGAGTCATGAAAACGATCGCGGCTATCACTATCGTCTTCCTTCCCACAACGGGCGTG
GCCAGCGTGGTGGGATCGCAGTTGCTGACGTCCAACTGGCATGACGACTCCAAGACGTGGACCATCATGGCCACC
CCTCTGTTCTGGTTGACCTGGTGGATAGCGATCCCGTTGACCGTATGCGTCGTCGTGCTGGCGCTGACCTGGCAG
TGGTGGGTGAATGCCGATCGGCCACAGGTCAGAGGTCGACTGCTGTTGCAGAGGCCAGTCGAGTGGGCGAATCTG
CTACGACAGAGAAAGTGA
Gene >Hirsu2|6474
ATGTCTTGGACCAGTGACCACGAATATCGAGCCTTCAGCACGGCCGCGCCTCGTCGCGACCTGTCGCTCGCTCCT
GCAGGACAATGGTCGCTCGACATCTGGGACGTGACCGACGGCATGCCGCCCCTTTCCAGGAGTCGGCTTTAATGC
CCTGGCTGACTAGTGGACGATAAAAGAGAATCCGGAGGGCAGATGGCATGTGGAGACGAGCCCCGACTGTCTTCG
CGACAAGGCGCAGCTGCGTATAGTGTGAGTCCCAGTGGGCTTGCGCGTTTTCGAGCTGTCCCGTGGCCCGGCATC
TGATAGCCACTGCATGGGCGAGCAGCTTCGCCCCGTTCAAGACGCCCCGACAGAGCTCCTCAGCGCAGATCTTGG
AGCTCTTCCGCATCCTGCGCATCCCCAGAGATGTCCTACGTCCGGCGTGCCACAACTTCGGCAGCCGACTGGACG
CCCACGGCCACTGCTCCTGGTTCCAGCACCTATTCAAGAACATACACGTCAGGCAGGATCCTGGCAAGCTTCCCG
AGGTCGATAATAGAGCCGCCAGCCCCGGTCACCCGCTTTCCACGCTTCCGCAGGCCGACTACAGCTGGATCAAGT
CCTGCTTCTTCCTACGAAGATATGAGGACGGTAGCACCATTCTCGTCTGCTTTGCGGCGCCGCCTCAAGTGGCCC
GTAGGATCGACCTCTTTACCGATACCGGAAGTTGGGGTGACGTCCAAGCCAACCCCTACGTCCTCTTCGACATGG
TGCTGGAGGGCTTGTTCCTCCAGGTCGATGAGATGGTTTGGAACATGGCCGCGGTCTGCGGTCCGCTAGAACACG
TACGTCTCCGCAAGAGAAGGCCAGGATCGTGGTCGAGGGAGACTGACGAGCCGGCAGTCTATTCTCGAGCTGGCA
CACACCCAAGATTTCGCCAAGCTCAACTCCCAGCTCTCCTTTGCCGCCCTACACAACTGTGCAAAGCACATCATT
CATCTAACAGAGGGACTTGAAGGCTGTGTCATGGTTGTCGATGCCGTCTTACTCAATTGCGACGGAGCCTCGGGT
GACCTGGGCCGTCAAGACTCATTCCCCCTTACCGACGTGAATTCGCGTGTCCACGTTCAGCAACAGCTGCGCGAG
TGCCTGCGACATCGACGCTTCCTCTTCCGCTCGACGCAGCTCCGCTTGTCAAGCCTGCAGAAGCGGACAGATAAT
ACTATTACGCTGGCCTTCAATGTCGTGACGCAGAAGGACTCGATGGAGATGACGCGCGATTCTAGAGTCATGAAA
ACGATCGCGGCTATCACTATCGTCTTCCTTCCCACAACGGGCGTGGCCAGCGTGGTGGGATCGCAGTTGCTGACG
TCCAACTGGCATGACGACTCCAAGACGTGGACCATCATGGCCACCCCTCTGTTCTGGTTGACCTGGTGGATAGCG
ATCCCGTTGACCGTATGCGTCGTCGTGCTGGCGCTGACCTGGCAGTGGTGGGTGAATGCCGATCGGCCACAGGTC
AGAGGTCGACTGCTGTTGCAGAGGCCAGTCGAGTGGGCGAATCTGCTACGACAGAGAAAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail