Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6467
Gene name
LocationContig_332:5623..9733
Strand-
Gene length (bp)4110
Transcript length (bp)3963
Coding sequence length (bp)3963
Protein length (aa) 1321

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 2.3E-16 258 475
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.3E-09 492 751

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39986|ATC6_YEAST Manganese-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPF1 PE=1 SV=1 4 1262 0.0E+00
sp|O14072|ATC4_SCHPO Manganese-transporting ATPase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta4 PE=3 SV=1 4 1265 0.0E+00
sp|Q9EPE9|AT131_MOUSE Manganese-transporting ATPase 13A1 OS=Mus musculus GN=Atp13a1 PE=1 SV=2 54 872 0.0E+00
sp|Q9HD20|AT131_HUMAN Manganese-transporting ATPase 13A1 OS=Homo sapiens GN=ATP13A1 PE=1 SV=2 54 872 0.0E+00
sp|P90747|AT131_CAEEL Probable manganese-transporting ATPase catp-8 OS=Caenorhabditis elegans GN=catp-8 PE=3 SV=3 24 877 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39986|ATC6_YEAST Manganese-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPF1 PE=1 SV=1 4 1262 0.0E+00
sp|O14072|ATC4_SCHPO Manganese-transporting ATPase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta4 PE=3 SV=1 4 1265 0.0E+00
sp|Q9EPE9|AT131_MOUSE Manganese-transporting ATPase 13A1 OS=Mus musculus GN=Atp13a1 PE=1 SV=2 54 872 0.0E+00
sp|Q9HD20|AT131_HUMAN Manganese-transporting ATPase 13A1 OS=Homo sapiens GN=ATP13A1 PE=1 SV=2 54 872 0.0E+00
sp|P90747|AT131_CAEEL Probable manganese-transporting ATPase catp-8 OS=Caenorhabditis elegans GN=catp-8 PE=3 SV=3 24 877 0.0E+00
sp|Q9LT02|PDR2_ARATH Probable manganese-transporting ATPase PDR2 OS=Arabidopsis thaliana GN=PDR2 PE=1 SV=1 10 873 0.0E+00
sp|O74431|ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.11c PE=3 SV=1 167 871 9.0E-85
sp|Q12697|YPK9_YEAST Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK9 PE=1 SV=1 126 871 6.0E-80
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 181 871 3.0E-79
sp|Q9H7F0|AT133_HUMAN Probable cation-transporting ATPase 13A3 OS=Homo sapiens GN=ATP13A3 PE=1 SV=4 181 871 1.0E-77
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 128 871 5.0E-76
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 119 871 1.0E-71
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 160 871 1.0E-71
sp|Q5ZKB7|AT134_CHICK Probable cation-transporting ATPase 13A4 OS=Gallus gallus GN=ATP13A4 PE=2 SV=1 182 871 1.0E-70
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 45 871 2.0E-70
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 131 871 3.0E-70
sp|Q4VNC0|AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens GN=ATP13A5 PE=2 SV=1 131 871 6.0E-69
sp|Q27533|YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans GN=W08D2.5 PE=3 SV=2 172 871 9.0E-69
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 131 871 8.0E-67
sp|P90747|AT131_CAEEL Probable manganese-transporting ATPase catp-8 OS=Caenorhabditis elegans GN=catp-8 PE=3 SV=3 1008 1255 3.0E-63
sp|Q9EPE9|AT131_MOUSE Manganese-transporting ATPase 13A1 OS=Mus musculus GN=Atp13a1 PE=1 SV=2 985 1251 1.0E-61
sp|Q9HD20|AT131_HUMAN Manganese-transporting ATPase 13A1 OS=Homo sapiens GN=ATP13A1 PE=1 SV=2 999 1232 7.0E-60
sp|Q9LT02|PDR2_ARATH Probable manganese-transporting ATPase PDR2 OS=Arabidopsis thaliana GN=PDR2 PE=1 SV=1 999 1253 9.0E-60
sp|O14022|CTA5_SCHPO Cation-transporting ATPase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta5 PE=3 SV=1 174 902 7.0E-51
sp|Q95050|ATX9_TETTH Probable cation-transporting ATPase 9 OS=Tetrahymena thermophila GN=TPA9 PE=2 SV=1 121 871 7.0E-40
sp|Q95JN5|AT133_MACFA Probable cation-transporting ATPase 13A3 (Fragment) OS=Macaca fascicularis GN=ATP13A3 PE=2 SV=2 181 492 6.0E-29
sp|P37278|ATCL_SYNE7 Calcium-transporting ATPase OS=Synechococcus elongatus (strain PCC 7942) GN=pacL PE=1 SV=2 244 875 4.0E-23
sp|P17326|AT1A_ARTSF Sodium/potassium-transporting ATPase subunit alpha-A OS=Artemia franciscana PE=2 SV=1 217 871 5.0E-22
sp|P9WPS9|CTPF_MYCTU Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpF PE=1 SV=1 262 882 6.0E-22
sp|P9WPS8|CTPF_MYCTO Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpF PE=2 SV=1 262 882 6.0E-22
sp|P63688|CTPF_MYCBO Probable cation-transporting ATPase F OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpF PE=3 SV=1 262 882 6.0E-22
sp|Q8Y8Q5|LMCA1_LISMO Calcium-transporting ATPase lmo0841 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0841 PE=1 SV=1 172 882 1.0E-20
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 241 871 1.0E-19
sp|O43108|ATC1_YARLI Calcium-transporting ATPase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PMR1 PE=3 SV=1 257 877 2.0E-19
sp|P35317|AT1A_HYDVU Sodium/potassium-transporting ATPase subunit alpha OS=Hydra vulgaris PE=2 SV=1 242 871 6.0E-19
sp|P37367|ATA1_SYNY3 Cation-transporting ATPase pma1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pma1 PE=3 SV=2 262 874 1.0E-18
sp|Q9YGL9|AT2A3_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Gallus gallus GN=ATP2A3 PE=2 SV=1 271 875 1.0E-18
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 226 880 3.0E-18
sp|O59868|ATC1_SCHPO Calcium-transporting ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmr1 PE=1 SV=1 165 871 4.0E-18
sp|P28774|AT1B_ARTSF Sodium/potassium-transporting ATPase subunit alpha-B OS=Artemia franciscana PE=2 SV=1 242 871 6.0E-18
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 298 883 6.0E-18
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 298 883 7.0E-18
sp|Q9CFU9|LLCA1_LACLA Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 195 883 1.0E-17
sp|Q64518|AT2A3_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Mus musculus GN=Atp2a3 PE=1 SV=3 226 875 3.0E-17
sp|P13586|ATC1_YEAST Calcium-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMR1 PE=1 SV=1 218 871 4.0E-17
sp|Q64578|AT2A1_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Rattus norvegicus GN=Atp2a1 PE=1 SV=1 229 875 4.0E-17
sp|Q8R429|AT2A1_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Mus musculus GN=Atp2a1 PE=1 SV=1 229 875 4.0E-17
sp|P06687|AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 242 871 5.0E-17
sp|Q6PIC6|AT1A3_MOUSE Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus GN=Atp1a3 PE=1 SV=1 242 871 5.0E-17
sp|P13637|AT1A3_HUMAN Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens GN=ATP1A3 PE=1 SV=3 242 871 9.0E-17
sp|P58312|AT1A3_OREMO Sodium/potassium-transporting ATPase subunit alpha-3 OS=Oreochromis mossambicus GN=atp1a3 PE=2 SV=1 242 871 1.0E-16
sp|Q04956|ATX1_PLAFA Probable cation-transporting ATPase 1 OS=Plasmodium falciparum PE=3 SV=1 343 513 1.0E-16
sp|P05025|AT1A_TORCA Sodium/potassium-transporting ATPase subunit alpha OS=Torpedo californica PE=1 SV=1 242 871 1.0E-16
sp|Q92123|AT1A1_XENLA Sodium/potassium-transporting ATPase subunit alpha-1 OS=Xenopus laevis GN=atp1a1 PE=2 SV=1 242 871 1.0E-16
sp|P24797|AT1A2_CHICK Sodium/potassium-transporting ATPase subunit alpha-2 OS=Gallus gallus GN=ATP1A2 PE=2 SV=1 242 871 1.0E-16
sp|P20647|AT2A2_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Oryctolagus cuniculus GN=ATP2A2 PE=2 SV=2 229 875 2.0E-16
sp|P04191|AT2A1_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Oryctolagus cuniculus GN=ATP2A1 PE=1 SV=1 229 875 3.0E-16
sp|P24798|AT1A3_CHICK Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus GN=ATP1A3 PE=2 SV=1 242 871 4.0E-16
sp|O14983|AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens GN=ATP2A1 PE=1 SV=1 229 875 4.0E-16
sp|P50996|ATP4A_CANLF Potassium-transporting ATPase alpha chain 1 OS=Canis lupus familiaris GN=ATP4A PE=2 SV=3 219 871 4.0E-16
sp|P30714|AT1A1_RHIMB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rhinella marina GN=ATP1A1 PE=1 SV=2 242 871 4.0E-16
sp|Q93084|AT2A3_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens GN=ATP2A3 PE=1 SV=2 226 875 4.0E-16
sp|Q9XES1|ECA4_ARATH Calcium-transporting ATPase 4, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA4 PE=2 SV=2 138 876 5.0E-16
sp|Q92105|AT2A1_PELES Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Pelophylax esculentus GN=ATP2A1 PE=2 SV=1 229 875 5.0E-16
sp|P13585|AT2A1_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Gallus gallus GN=ATP2A1 PE=2 SV=2 229 875 5.0E-16
sp|P27112|ATP4A_RABIT Potassium-transporting ATPase alpha chain 1 OS=Oryctolagus cuniculus GN=ATP4A PE=2 SV=3 219 871 6.0E-16
sp|P16615|AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 229 875 9.0E-16
sp|Q92036|AT12A_RHIMB Potassium-transporting ATPase alpha chain 2 OS=Rhinella marina GN=ATP12A PE=2 SV=1 449 871 1.0E-15
sp|Q92030|AT1A1_ANGAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Anguilla anguilla GN=atp1a1 PE=2 SV=1 242 871 1.0E-15
sp|P18596|AT2A3_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus GN=Atp2a3 PE=1 SV=2 226 875 1.0E-15
sp|P09572|AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus GN=ATP1A1 PE=2 SV=1 242 871 1.0E-15
sp|P19156|ATP4A_PIG Potassium-transporting ATPase alpha chain 1 OS=Sus scrofa GN=ATP4A PE=1 SV=3 219 871 2.0E-15
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 241 877 2.0E-15
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 625 905 2.0E-15
sp|P06685|AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus GN=Atp1a1 PE=1 SV=1 242 871 2.0E-15
sp|O55143|AT2A2_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus GN=Atp2a2 PE=1 SV=2 229 875 2.0E-15
sp|Q8VDN2|AT1A1_MOUSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus GN=Atp1a1 PE=1 SV=1 242 871 2.0E-15
sp|Q9YH26|AT1A1_OREMO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oreochromis mossambicus GN=atp1a1 PE=2 SV=2 449 871 3.0E-15
sp|P09626|ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus GN=Atp4a PE=1 SV=3 219 871 4.0E-15
sp|O46674|AT2A2_CANLF Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Canis lupus familiaris GN=ATP2A2 PE=2 SV=1 229 875 4.0E-15
sp|P11507|AT2A2_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Rattus norvegicus GN=Atp2a2 PE=1 SV=1 229 875 4.0E-15
sp|Q03669|AT2A2_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Gallus gallus GN=ATP2A2 PE=2 SV=2 229 875 6.0E-15
sp|Q9N0Z6|AT1A1_RABIT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oryctolagus cuniculus GN=ATP1A1 PE=1 SV=2 242 871 6.0E-15
sp|P25489|AT1A1_CATCO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Catostomus commersonii GN=atp1a1 PE=2 SV=1 242 871 6.0E-15
sp|P35316|ATC_ARTSF Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Artemia franciscana PE=2 SV=1 229 875 6.0E-15
sp|Q04956|ATX1_PLAFA Probable cation-transporting ATPase 1 OS=Plasmodium falciparum PE=3 SV=1 637 794 7.0E-15
sp|P06686|AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus GN=Atp1a2 PE=1 SV=1 242 871 7.0E-15
sp|Q6PIE5|AT1A2_MOUSE Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus GN=Atp1a2 PE=1 SV=1 242 871 7.0E-15
sp|Q0VCY0|AT2A1_BOVIN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Bos taurus GN=ATP2A1 PE=1 SV=1 229 875 9.0E-15
sp|A2VDL6|AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus GN=ATP1A2 PE=2 SV=1 242 871 9.0E-15
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 1007 1276 9.0E-15
sp|Q9TV52|AT12A_RABIT Potassium-transporting ATPase alpha chain 2 OS=Oryctolagus cuniculus GN=ATP12A PE=2 SV=1 414 871 1.0E-14
sp|P13607|ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster GN=Atpalpha PE=1 SV=3 242 871 1.0E-14
sp|Q5RCD8|AT1A2_PONAB Sodium/potassium-transporting ATPase subunit alpha-2 OS=Pongo abelii GN=ATP1A2 PE=2 SV=1 242 871 1.0E-14
sp|P22036|ATMB_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtB PE=1 SV=3 204 893 2.0E-14
sp|P05023|AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 242 871 2.0E-14
sp|P20648|ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens GN=ATP4A PE=2 SV=5 219 871 2.0E-14
sp|P50993|AT1A2_HUMAN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens GN=ATP1A2 PE=1 SV=1 242 871 2.0E-14
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 170 871 2.0E-14
sp|D2WKD8|AT1A2_PIG Sodium/potassium-transporting ATPase subunit alpha-2 OS=Sus scrofa GN=ATP1A2 PE=1 SV=1 242 871 2.0E-14
sp|Q5RDR3|AT1A1_PONAB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Pongo abelii GN=ATP1A1 PE=2 SV=1 242 871 3.0E-14
sp|Q64436|ATP4A_MOUSE Potassium-transporting ATPase alpha chain 1 OS=Mus musculus GN=Atp4a PE=1 SV=3 254 871 3.0E-14
sp|Q08DA1|AT1A1_BOVIN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Bos taurus GN=ATP1A1 PE=2 SV=1 242 871 3.0E-14
sp|P54707|AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens GN=ATP12A PE=1 SV=3 443 871 4.0E-14
sp|P04074|AT1A1_SHEEP Sodium/potassium-transporting ATPase subunit alpha-1 OS=Ovis aries GN=ATP1A1 PE=1 SV=1 242 871 4.0E-14
sp|Q92126|ATP4A_XENLA Potassium-transporting ATPase alpha chain 1 OS=Xenopus laevis GN=atp4a PE=2 SV=3 254 871 5.0E-14
sp|Q9WV27|AT1A4_MOUSE Sodium/potassium-transporting ATPase subunit alpha-4 OS=Mus musculus GN=Atp1a4 PE=1 SV=3 242 871 5.0E-14
sp|P92939|ECA1_ARATH Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA1 PE=1 SV=2 166 876 7.0E-14
sp|P50997|AT1A1_CANLF Sodium/potassium-transporting ATPase subunit alpha-1 OS=Canis lupus familiaris GN=ATP1A1 PE=2 SV=1 242 871 1.0E-13
sp|P05024|AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa GN=ATP1A1 PE=1 SV=1 242 871 1.0E-13
sp|P18907|AT1A1_HORSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Equus caballus GN=ATP1A1 PE=3 SV=1 242 871 1.0E-13
sp|Q12697|YPK9_YEAST Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK9 PE=1 SV=1 1007 1250 2.0E-13
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 1007 1274 2.0E-13
sp|Q9Z1W8|AT12A_MOUSE Potassium-transporting ATPase alpha chain 2 OS=Mus musculus GN=Atp12a PE=1 SV=3 443 871 3.0E-13
sp|P54708|AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus GN=Atp12a PE=1 SV=1 241 871 3.0E-13
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 256 871 4.0E-13
sp|O34431|ATCL_BACSU Calcium-transporting ATPase OS=Bacillus subtilis (strain 168) GN=yloB PE=1 SV=1 442 883 4.0E-13
sp|Q8R4C1|AT2C2_RAT Calcium-transporting ATPase type 2C member 2 OS=Rattus norvegicus GN=Atp2c2 PE=2 SV=1 241 871 5.0E-13
sp|Q6RWA9|AT1A_TAESO Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 193 871 6.0E-13
sp|Q64541|AT1A4_RAT Sodium/potassium-transporting ATPase subunit alpha-4 OS=Rattus norvegicus GN=Atp1a4 PE=2 SV=1 242 871 1.0E-12
sp|Q04956|ATX1_PLAFA Probable cation-transporting ATPase 1 OS=Plasmodium falciparum PE=3 SV=1 167 336 2.0E-12
sp|Q13733|AT1A4_HUMAN Sodium/potassium-transporting ATPase subunit alpha-4 OS=Homo sapiens GN=ATP1A4 PE=1 SV=3 242 871 3.0E-12
sp|A7L9Z8|AT2C2_MOUSE Calcium-transporting ATPase type 2C member 2 OS=Mus musculus GN=Atp2c2 PE=2 SV=1 241 871 3.0E-12
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 172 871 5.0E-12
sp|Q9LIK7|ACA13_ARATH Putative calcium-transporting ATPase 13, plasma membrane-type OS=Arabidopsis thaliana GN=ACA13 PE=3 SV=1 449 876 5.0E-12
sp|P54209|ATC1_DUNBI Cation-transporting ATPase CA1 OS=Dunaliella bioculata GN=CA1 PE=2 SV=1 640 888 6.0E-12
sp|Q8RUN1|ACA3_ORYSJ Calcium-transporting ATPase 3, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os01g0939100 PE=2 SV=1 170 871 7.0E-12
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 228 871 1.0E-11
sp|Q9LY77|ACA12_ARATH Calcium-transporting ATPase 12, plasma membrane-type OS=Arabidopsis thaliana GN=ACA12 PE=2 SV=1 171 876 2.0E-11
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 222 876 4.0E-11
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 279 886 5.0E-11
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 231 871 6.0E-11
sp|Q64392|AT12A_CAVPO Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 241 871 8.0E-11
sp|Q5ZKB7|AT134_CHICK Probable cation-transporting ATPase 13A4 OS=Gallus gallus GN=ATP13A4 PE=2 SV=1 1012 1249 9.0E-11
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 256 871 1.0E-10
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 1012 1249 1.0E-10
sp|Q9H7F0|AT133_HUMAN Probable cation-transporting ATPase 13A3 OS=Homo sapiens GN=ATP13A3 PE=1 SV=4 1012 1249 1.0E-10
sp|O81108|ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1 231 871 2.0E-10
sp|O74431|ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.11c PE=3 SV=1 1007 1192 4.0E-10
sp|O30085|COPB_ARCFU Copper-exporting P-type ATPase B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copB PE=1 SV=1 221 541 6.0E-10
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 490 886 7.0E-10
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 1012 1249 1.0E-09
sp|Q4VNC0|AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens GN=ATP13A5 PE=2 SV=1 1012 1249 2.0E-09
sp|Q37145|ACA1_ARATH Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3 276 876 2.0E-09
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 226 871 2.0E-09
sp|P36640|ATMA_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtA PE=2 SV=1 268 759 6.0E-09
sp|D0ZTB2|ATMA_SALT1 Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=mgtA PE=2 SV=1 268 759 6.0E-09
sp|Q27533|YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans GN=W08D2.5 PE=3 SV=2 1007 1192 1.0E-08
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 242 871 1.0E-08
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 599 871 1.0E-08
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 279 872 2.0E-08
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 1012 1249 2.0E-08
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 1007 1201 2.0E-08
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 490 871 4.0E-08
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 440 876 5.0E-08
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 599 871 7.0E-08
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 549 871 2.0E-07
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 490 871 6.0E-07
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 1012 1104 8.0E-07
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 490 871 8.0E-07
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 593 886 9.0E-07
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 599 871 2.0E-06
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 640 873 3.0E-06
sp|P0ABB8|ATMA_ECOLI Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli (strain K12) GN=mgtA PE=1 SV=1 268 522 7.0E-06
sp|P0ABB9|ATMA_ECO57 Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli O157:H7 GN=mgtA PE=3 SV=1 268 522 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 58 80 22
3 201 218 17
4 222 241 19
5 407 429 22
6 1074 1096 22
7 1109 1131 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6467
MAPLVDSAQIQQAELLRPLPFYLHAYIWPFTIIWPVFLRYYLTPHLYEQHIGAPEWTFVWCGTIITIQSLVWLST
HWSVGLDARFTAKKARDVQDAQLIKVLPIANAGSGEICRLVRDKVGGKTNLSFLFQKRRFLYNPDTNTFSPLRFD
IDAEPKPDIGHFQSWRGLEKQSDISRVEQHYGTNTFDIPVATFTELFKEHAVAPFFVFQIFCVGLWLLDDYWYYS
LFTLFMLVAFESTVVWQRQRTLNEFRGMSIKPYDIWVFRLGKWTEIQTDALLPGDLVSVGRTKEDSGVACDLLLV
EGTAIVNEAMLSGESTPLLKDSVQLRPGDAPLDPEGLDKNAFLWGGTKVLQVTHGNPEQEKPALASKVPSPPDNG
AMAVVTKTGFETSQGSLVRTMIYSTERVSANNFEALLFILFLLIFALAASWYVWDEGVRKDRKRSKLLLDCVLIV
TSVVPPELPMELSLAVNTSLAALSKLAIFCTEPFRIPYGGRIDVACFDKTGTLTGEDLVVEGIAGLGLANSEIAD
KKEADGAHSNMTPVVDASLETQLVLATAHALVKLDEGEIVGDPMEKATLSSLGWTLGRNDVLASTNKVGKTQGTV
QIKRRFQFSSALKRQSSVATVHGSSSLTGKKLKGTFVGVKGAPETIMKMLVDVPADYEETYKYFTRKGSRVLALA
YKQLTVDSELGTGKINDLKREKVECDLTFAGFLVLHCPLKEDAKEAVQMLNESSHRVVMITGDNPLTAVHVAREV
EIVDREVLILDAPEDNAGGQKLVWRSVDDKVSVPVDPSKPIDAEILRTKDLCVTGYALAKFKGQSGWNSLLRHTW
VYARVSPKQKEEILLGLKDMGYYTLMAGDGTNDVGALKQAHIGIALLNGTKDDLARIAEHSRNTKMKEMYQKQCD
LMKRFNQPTPPVPAMIAHLYPPGPTNPNYMKAIEREAKNRNMTPEAYAKAQGHPAETIVSPGAQSLVNANDARSA
RQAEVTKKAAGFADKLTSGMLEAELGDDEPPTLKLGDASVAAPFTSKLRDVIAVPNIIRQGRCTLVATIQMYKIL
ALNCLISAYSLSVLYLEGIKFGDTQYTISGMLMSVCFLSISRARVVEGLSKERPQPNIFNVYIIGSILGQFAVHI
VTLIYIARLCDKIAPRSTDNLDLEAEFEPSLLNSAIYLLQLIQQVSTFAINYQGRPFRESLSENRAMFYGIVGVS
GLAFVCALELVPEINEGMKLVRFTEEFKMKMAACMVIDYALCFVIEKGLKMGFSDYRPRDIADRRPEQLEREAAR
KKVIEEKKAAEEEEKRLEKVAEFERQVEERKRKLREWRAGPQRAQ*
Coding >Hirsu2|6467
ATGGCGCCCCTCGTCGACAGCGCCCAGATCCAGCAGGCCGAGCTGCTGCGCCCGCTTCCCTTCTACCTCCATGCC
TATATCTGGCCCTTTACCATCATCTGGCCCGTCTTCCTGCGCTACTACCTGACGCCCCATCTGTATGAGCAGCAC
ATCGGCGCCCCCGAGTGGACGTTCGTCTGGTGCGGGACCATCATCACCATCCAGTCGCTCGTCTGGTTGAGCACC
CACTGGAGTGTCGGCCTGGACGCGCGCTTCACGGCGAAGAAGGCCCGTGACGTTCAGGATGCCCAGCTCATCAAG
GTACTCCCGATAGCCAACGCCGGCTCGGGGGAGATCTGCAGACTGGTTCGGGACAAGGTTGGCGGAAAGACGAAC
CTCTCCTTTCTCTTCCAGAAACGTCGATTTCTCTATAATCCGGATACGAATACCTTCAGCCCGCTCAGGTTCGAC
ATCGACGCGGAACCCAAGCCTGATATCGGCCATTTCCAGTCGTGGCGCGGCCTCGAGAAGCAATCCGACATCTCC
CGCGTCGAGCAGCACTATGGCACAAACACCTTCGACATTCCAGTTGCGACCTTCACCGAGCTCTTCAAAGAACAC
GCCGTTGCGCCCTTCTTCGTCTTTCAGATCTTTTGCGTCGGCCTATGGCTTCTCGACGACTATTGGTATTACTCG
CTCTTCACCCTCTTCATGCTCGTCGCCTTCGAGAGCACCGTCGTCTGGCAGCGCCAGCGCACCCTCAACGAATTC
CGCGGCATGAGCATCAAGCCCTACGATATCTGGGTCTTCCGGCTCGGCAAGTGGACTGAGATTCAGACCGACGCT
CTCCTCCCCGGCGATCTTGTGTCTGTCGGCCGGACCAAGGAGGATAGTGGCGTTGCTTGCGATCTGCTCCTCGTC
GAGGGAACTGCCATCGTCAACGAAGCCATGCTGTCGGGAGAGAGCACTCCCCTGCTCAAGGACTCCGTTCAGCTG
CGCCCTGGGGACGCTCCACTTGACCCCGAGGGCCTGGACAAGAATGCCTTCCTCTGGGGAGGCACCAAGGTCCTC
CAGGTAACCCACGGCAACCCCGAGCAGGAGAAGCCGGCCCTTGCTTCCAAGGTCCCCTCGCCCCCGGACAATGGT
GCCATGGCCGTCGTCACCAAGACCGGCTTCGAAACTTCCCAGGGCAGCCTGGTCCGGACCATGATCTACTCGACT
GAGCGCGTCTCCGCCAACAACTTTGAAGCACTTCTCTTCATCCTCTTCCTCCTCATCTTCGCCCTCGCCGCATCG
TGGTACGTCTGGGACGAGGGCGTTCGCAAGGACCGCAAGCGCTCCAAGCTCCTGTTGGATTGCGTCTTGATCGTC
ACCAGCGTGGTCCCTCCCGAGCTGCCCATGGAGCTTAGTCTCGCCGTCAACACTAGCTTGGCAGCTCTCTCTAAG
CTCGCCATATTCTGCACCGAGCCGTTCCGAATCCCTTACGGCGGCCGCATTGACGTCGCCTGCTTCGACAAGACG
GGCACTCTTACCGGCGAAGACCTGGTAGTCGAGGGCATTGCCGGCCTCGGCCTCGCCAACTCGGAGATTGCCGAC
AAGAAAGAGGCCGATGGTGCCCACTCAAACATGACCCCGGTCGTCGACGCCAGCCTCGAGACTCAACTTGTTCTG
GCAACAGCGCACGCACTTGTCAAGTTGGACGAGGGAGAAATTGTCGGTGATCCGATGGAAAAGGCCACTCTTTCA
TCCCTCGGCTGGACCCTGGGTCGCAATGATGTTCTCGCGAGCACGAACAAGGTCGGCAAAACACAAGGCACCGTT
CAGATCAAGCGCAGGTTCCAGTTCTCGTCTGCCCTGAAGCGACAGAGCTCGGTAGCTACGGTCCACGGCTCCAGC
TCGCTGACGGGCAAGAAGCTCAAGGGAACATTCGTTGGGGTGAAGGGCGCGCCGGAGACCATCATGAAGATGCTG
GTTGACGTACCCGCAGACTACGAGGAGACGTACAAATACTTCACCCGCAAAGGCTCCCGAGTTCTGGCCCTCGCA
TACAAGCAGCTGACTGTCGACTCCGAACTGGGCACCGGCAAAATCAATGACCTAAAGCGTGAAAAGGTCGAGTGC
GACCTGACTTTTGCTGGCTTCCTTGTTCTACATTGCCCTCTCAAAGAGGACGCCAAGGAGGCCGTTCAGATGCTC
AACGAGAGCAGTCACCGCGTGGTGATGATTACCGGAGACAACCCGCTGACTGCCGTCCACGTCGCTCGCGAGGTC
GAAATAGTAGACCGCGAGGTTCTTATCCTGGATGCGCCCGAGGACAACGCCGGCGGCCAAAAGCTCGTCTGGCGG
AGCGTTGACGACAAAGTTAGCGTTCCGGTAGACCCGTCCAAGCCTATCGATGCCGAGATCCTGCGGACGAAGGAT
CTCTGCGTCACGGGATATGCCTTGGCCAAGTTCAAGGGCCAGTCTGGCTGGAACTCTCTCTTGCGACACACCTGG
GTCTACGCCCGAGTCTCCCCAAAGCAAAAGGAGGAAATCCTACTTGGTCTCAAGGACATGGGTTACTACACGCTG
ATGGCTGGTGACGGCACCAACGACGTCGGAGCCCTCAAGCAGGCACATATCGGCATTGCGCTGCTGAACGGCACC
AAGGACGACTTGGCCCGCATCGCGGAACACTCCCGCAACACGAAGATGAAGGAGATGTATCAGAAGCAGTGCGAT
CTCATGAAGCGCTTCAACCAGCCCACTCCACCGGTTCCGGCCATGATTGCCCATCTCTACCCCCCGGGTCCGACG
AACCCCAATTACATGAAGGCCATCGAGCGCGAGGCTAAGAACAGGAACATGACGCCCGAAGCGTACGCCAAGGCG
CAGGGCCACCCGGCCGAGACAATTGTTTCGCCCGGTGCCCAGAGCCTGGTCAACGCCAACGACGCCCGCAGTGCC
CGGCAGGCCGAGGTGACGAAAAAGGCGGCCGGCTTCGCCGACAAGCTCACCTCGGGCATGCTCGAGGCCGAGCTT
GGCGACGACGAGCCGCCGACTCTGAAGCTGGGCGACGCCTCGGTCGCCGCGCCCTTCACGTCGAAGCTCCGAGAT
GTCATTGCCGTCCCCAACATTATCCGCCAAGGCCGGTGCACCCTCGTGGCCACGATCCAGATGTACAAGATCCTC
GCCCTGAACTGCCTCATCAGCGCTTACTCGCTGTCTGTCCTGTACCTCGAGGGCATCAAGTTTGGCGATACCCAG
TACACCATTAGCGGCATGCTCATGTCGGTGTGTTTCTTGAGCATCTCCCGAGCTCGCGTGGTCGAGGGTCTCAGC
AAAGAGCGCCCGCAGCCCAACATCTTCAACGTCTACATCATCGGCTCGATACTCGGGCAGTTCGCCGTCCACATT
GTCACACTCATCTACATTGCCCGTCTCTGTGACAAGATTGCTCCGCGCTCCACCGACAACCTCGATCTCGAGGCC
GAGTTCGAGCCATCTCTGCTGAACTCGGCCATTTACCTCCTCCAGCTCATCCAGCAGGTGTCGACGTTCGCCATC
AACTACCAGGGCCGGCCGTTCCGCGAGTCGCTGTCGGAGAACAGGGCCATGTTCTACGGCATCGTCGGCGTCTCG
GGCCTGGCCTTCGTGTGCGCGCTGGAGCTAGTGCCCGAGATCAACGAGGGCATGAAGCTCGTCCGCTTCACCGAG
GAATTCAAGATGAAGATGGCGGCGTGCATGGTCATCGACTACGCGCTGTGCTTCGTCATCGAGAAAGGCCTCAAA
ATGGGCTTCAGCGACTACCGGCCGCGCGACATCGCGGACCGACGGCCGGAGCAGCTCGAGAGGGAGGCCGCGCGC
AAGAAGGTAATCGAGGAGAAGAAAGCGGCCGAGGAAGAGGAGAAGCGGCTGGAGAAGGTGGCCGAATTCGAGCGC
CAGGTCGAGGAGCGCAAGCGGAAGTTGCGGGAGTGGAGGGCCGGCCCCCAGCGGGCGCAGTAG
Transcript >Hirsu2|6467
ATGGCGCCCCTCGTCGACAGCGCCCAGATCCAGCAGGCCGAGCTGCTGCGCCCGCTTCCCTTCTACCTCCATGCC
TATATCTGGCCCTTTACCATCATCTGGCCCGTCTTCCTGCGCTACTACCTGACGCCCCATCTGTATGAGCAGCAC
ATCGGCGCCCCCGAGTGGACGTTCGTCTGGTGCGGGACCATCATCACCATCCAGTCGCTCGTCTGGTTGAGCACC
CACTGGAGTGTCGGCCTGGACGCGCGCTTCACGGCGAAGAAGGCCCGTGACGTTCAGGATGCCCAGCTCATCAAG
GTACTCCCGATAGCCAACGCCGGCTCGGGGGAGATCTGCAGACTGGTTCGGGACAAGGTTGGCGGAAAGACGAAC
CTCTCCTTTCTCTTCCAGAAACGTCGATTTCTCTATAATCCGGATACGAATACCTTCAGCCCGCTCAGGTTCGAC
ATCGACGCGGAACCCAAGCCTGATATCGGCCATTTCCAGTCGTGGCGCGGCCTCGAGAAGCAATCCGACATCTCC
CGCGTCGAGCAGCACTATGGCACAAACACCTTCGACATTCCAGTTGCGACCTTCACCGAGCTCTTCAAAGAACAC
GCCGTTGCGCCCTTCTTCGTCTTTCAGATCTTTTGCGTCGGCCTATGGCTTCTCGACGACTATTGGTATTACTCG
CTCTTCACCCTCTTCATGCTCGTCGCCTTCGAGAGCACCGTCGTCTGGCAGCGCCAGCGCACCCTCAACGAATTC
CGCGGCATGAGCATCAAGCCCTACGATATCTGGGTCTTCCGGCTCGGCAAGTGGACTGAGATTCAGACCGACGCT
CTCCTCCCCGGCGATCTTGTGTCTGTCGGCCGGACCAAGGAGGATAGTGGCGTTGCTTGCGATCTGCTCCTCGTC
GAGGGAACTGCCATCGTCAACGAAGCCATGCTGTCGGGAGAGAGCACTCCCCTGCTCAAGGACTCCGTTCAGCTG
CGCCCTGGGGACGCTCCACTTGACCCCGAGGGCCTGGACAAGAATGCCTTCCTCTGGGGAGGCACCAAGGTCCTC
CAGGTAACCCACGGCAACCCCGAGCAGGAGAAGCCGGCCCTTGCTTCCAAGGTCCCCTCGCCCCCGGACAATGGT
GCCATGGCCGTCGTCACCAAGACCGGCTTCGAAACTTCCCAGGGCAGCCTGGTCCGGACCATGATCTACTCGACT
GAGCGCGTCTCCGCCAACAACTTTGAAGCACTTCTCTTCATCCTCTTCCTCCTCATCTTCGCCCTCGCCGCATCG
TGGTACGTCTGGGACGAGGGCGTTCGCAAGGACCGCAAGCGCTCCAAGCTCCTGTTGGATTGCGTCTTGATCGTC
ACCAGCGTGGTCCCTCCCGAGCTGCCCATGGAGCTTAGTCTCGCCGTCAACACTAGCTTGGCAGCTCTCTCTAAG
CTCGCCATATTCTGCACCGAGCCGTTCCGAATCCCTTACGGCGGCCGCATTGACGTCGCCTGCTTCGACAAGACG
GGCACTCTTACCGGCGAAGACCTGGTAGTCGAGGGCATTGCCGGCCTCGGCCTCGCCAACTCGGAGATTGCCGAC
AAGAAAGAGGCCGATGGTGCCCACTCAAACATGACCCCGGTCGTCGACGCCAGCCTCGAGACTCAACTTGTTCTG
GCAACAGCGCACGCACTTGTCAAGTTGGACGAGGGAGAAATTGTCGGTGATCCGATGGAAAAGGCCACTCTTTCA
TCCCTCGGCTGGACCCTGGGTCGCAATGATGTTCTCGCGAGCACGAACAAGGTCGGCAAAACACAAGGCACCGTT
CAGATCAAGCGCAGGTTCCAGTTCTCGTCTGCCCTGAAGCGACAGAGCTCGGTAGCTACGGTCCACGGCTCCAGC
TCGCTGACGGGCAAGAAGCTCAAGGGAACATTCGTTGGGGTGAAGGGCGCGCCGGAGACCATCATGAAGATGCTG
GTTGACGTACCCGCAGACTACGAGGAGACGTACAAATACTTCACCCGCAAAGGCTCCCGAGTTCTGGCCCTCGCA
TACAAGCAGCTGACTGTCGACTCCGAACTGGGCACCGGCAAAATCAATGACCTAAAGCGTGAAAAGGTCGAGTGC
GACCTGACTTTTGCTGGCTTCCTTGTTCTACATTGCCCTCTCAAAGAGGACGCCAAGGAGGCCGTTCAGATGCTC
AACGAGAGCAGTCACCGCGTGGTGATGATTACCGGAGACAACCCGCTGACTGCCGTCCACGTCGCTCGCGAGGTC
GAAATAGTAGACCGCGAGGTTCTTATCCTGGATGCGCCCGAGGACAACGCCGGCGGCCAAAAGCTCGTCTGGCGG
AGCGTTGACGACAAAGTTAGCGTTCCGGTAGACCCGTCCAAGCCTATCGATGCCGAGATCCTGCGGACGAAGGAT
CTCTGCGTCACGGGATATGCCTTGGCCAAGTTCAAGGGCCAGTCTGGCTGGAACTCTCTCTTGCGACACACCTGG
GTCTACGCCCGAGTCTCCCCAAAGCAAAAGGAGGAAATCCTACTTGGTCTCAAGGACATGGGTTACTACACGCTG
ATGGCTGGTGACGGCACCAACGACGTCGGAGCCCTCAAGCAGGCACATATCGGCATTGCGCTGCTGAACGGCACC
AAGGACGACTTGGCCCGCATCGCGGAACACTCCCGCAACACGAAGATGAAGGAGATGTATCAGAAGCAGTGCGAT
CTCATGAAGCGCTTCAACCAGCCCACTCCACCGGTTCCGGCCATGATTGCCCATCTCTACCCCCCGGGTCCGACG
AACCCCAATTACATGAAGGCCATCGAGCGCGAGGCTAAGAACAGGAACATGACGCCCGAAGCGTACGCCAAGGCG
CAGGGCCACCCGGCCGAGACAATTGTTTCGCCCGGTGCCCAGAGCCTGGTCAACGCCAACGACGCCCGCAGTGCC
CGGCAGGCCGAGGTGACGAAAAAGGCGGCCGGCTTCGCCGACAAGCTCACCTCGGGCATGCTCGAGGCCGAGCTT
GGCGACGACGAGCCGCCGACTCTGAAGCTGGGCGACGCCTCGGTCGCCGCGCCCTTCACGTCGAAGCTCCGAGAT
GTCATTGCCGTCCCCAACATTATCCGCCAAGGCCGGTGCACCCTCGTGGCCACGATCCAGATGTACAAGATCCTC
GCCCTGAACTGCCTCATCAGCGCTTACTCGCTGTCTGTCCTGTACCTCGAGGGCATCAAGTTTGGCGATACCCAG
TACACCATTAGCGGCATGCTCATGTCGGTGTGTTTCTTGAGCATCTCCCGAGCTCGCGTGGTCGAGGGTCTCAGC
AAAGAGCGCCCGCAGCCCAACATCTTCAACGTCTACATCATCGGCTCGATACTCGGGCAGTTCGCCGTCCACATT
GTCACACTCATCTACATTGCCCGTCTCTGTGACAAGATTGCTCCGCGCTCCACCGACAACCTCGATCTCGAGGCC
GAGTTCGAGCCATCTCTGCTGAACTCGGCCATTTACCTCCTCCAGCTCATCCAGCAGGTGTCGACGTTCGCCATC
AACTACCAGGGCCGGCCGTTCCGCGAGTCGCTGTCGGAGAACAGGGCCATGTTCTACGGCATCGTCGGCGTCTCG
GGCCTGGCCTTCGTGTGCGCGCTGGAGCTAGTGCCCGAGATCAACGAGGGCATGAAGCTCGTCCGCTTCACCGAG
GAATTCAAGATGAAGATGGCGGCGTGCATGGTCATCGACTACGCGCTGTGCTTCGTCATCGAGAAAGGCCTCAAA
ATGGGCTTCAGCGACTACCGGCCGCGCGACATCGCGGACCGACGGCCGGAGCAGCTCGAGAGGGAGGCCGCGCGC
AAGAAGGTAATCGAGGAGAAGAAAGCGGCCGAGGAAGAGGAGAAGCGGCTGGAGAAGGTGGCCGAATTCGAGCGC
CAGGTCGAGGAGCGCAAGCGGAAGTTGCGGGAGTGGAGGGCCGGCCCCCAGCGGGCGCAGTAG
Gene >Hirsu2|6467
ATGGCGCCCCTCGTCGACAGCGCCCAGATCCAGCAGGCCGAGCTGCTGCGCCCGCTTCCCTTCTACCTCCATGCC
TATATCTGGCCCTTTACCATCATCTGGCCCGTCTTCCTGCGCTACTACCTGACGCCCCATCTGTATGAGCAGCAC
ATCGGCGCCCCCGAGTGGACGTTCGTCTGGTGCGGGACCATCATCACCATCCAGTCGCTCGTCTGGTTGAGCACC
CACTGGAGTGTCGGCCTGGACGCGCGCTTCACGGCGAAGAAGGCCCGTGACGTTCAGGATGCCCAGCTCATCAAG
GTACTCCCGATAGCCAACGCCGGCTCGGGGGAGATCTGCAGACTGGTTCGGGACAAGGTAAGCGCGCTGGTATCT
GATCTCAACGCTGGCAAGGCTGACCGAGAATGTCCGGCGACTAGGTTGGCGGAAAGACGAACCTCTCCTTTCTCT
TCCAGAAACGTCGATTTCTCTATAATCCGGATACGAATACCTTCAGCCCGCTCAGGTTCGACATCGACGCGGAAC
CCAAGCCTGATATCGGCCATTTCCAGTCGTGGCGCGGCCTCGAGAAGCAATCCGACATCTCCCGCGTCGAGCAGC
ACTATGGCACAAACACCTTCGACATTCCAGTTGCGACCTTCACCGAGCTCTTCAAAGAACACGCCGTTGCGCCCT
TCTTCGTCTTTCAGATCTTTTGCGTCGGCCTATGGCTTCTCGACGACTATTGGTATTACTCGCTCTTCACCCTCT
TCATGCTCGTCGCCTTCGAGAGCACCGTCGTCTGGCAGCGCCAGCGCACCCTCAACGAATTCCGCGGCATGAGCA
TCAAGCCCTACGATATCTGGGTCTTCCGGCTCGGCAAGTGGACTGAGATTCAGACCGACGCTCTCCTCCCCGGCG
ATCTTGTGTCTGTCGGCCGGACCAAGGAGGATAGTGGCGTTGCTTGCGATCTGCTCCTCGTCGAGGGAACTGCCA
TCGTCAACGAAGCCATGCTGTCGGGAGAGAGCACTCCCCTGCTCAAGGACTCCGTTCAGCTGCGCCCTGGGGACG
CTCCACTTGACCCCGAGGGCCTGGACAAGAATGCCTTCCTCTGGGGAGGCACCAAGGTCCTCCAGGTAACCCACG
GCAACCCCGAGCAGGAGAAGCCGGCCCTTGCTTCCAAGGTCCCCTCGCCCCCGGACAATGGTGCCATGGCCGTCG
TCACCAAGACCGGCTTCGAAACTTCCCAGGGCAGCCTGGTCCGGACCATGATCTACTCGACTGAGCGCGTCTCCG
CCAACAACTTTGAAGCACTTCTCTTCATCCTCTTCCTCCTCATCTTCGCCCTCGCCGCATCGTGGTACGTCTGGG
ACGAGGGCGTTCGCAAGGACCGCAAGCGCTCCAAGCTCCTGTTGGATTGCGTCTTGATCGTCACCAGCGTGGTCC
CTCCCGAGCTGCCCATGGAGCTTAGTCTCGCCGTCAACACTAGCTTGGCAGCTCTCTCTAAGCTCGCCATATTCT
GCACCGAGCCGTTCCGAATCCCTTACGGCGGCCGCATTGACGTCGCCTGCTTCGACAAGACGGGCACTCTTACCG
GCGAAGACCTGGTAGTCGAGGGCATTGCCGGCCTCGGCCTCGCCAACTCGGAGATTGCCGACAAGAAAGAGGCCG
ATGGTGCCCACTCAAACATGACCCCGGTCGTCGACGCCAGCCTCGAGACTCAACTTGTTCTGGCAACAGCGCACG
CACTTGTCAAGTTGGACGAGGGAGAAATTGTCGGTGATCCGATGGAAAAGGCCACTCTTTCATCCCTCGGCTGGA
CCCTGGGTCGCAATGATGTTCTCGCGAGCACGAACAAGGTCGGCAAAACACAAGGCACCGTTCAGATCAAGCGCA
GGTTCCAGTTCTCGTCTGCCCTGAAGCGACAGAGCTCGGTAGCTACGGTCCACGGCTCCAGCTCGCTGACGGGCA
AGAAGCTCAAGGGAACATTCGTTGGGGTGAAGGGCGCGCCGGAGACCATCATGAAGATGCTGGTTGACGTACCCG
CAGACTACGAGGAGACGTACAAATACTTCACCCGCAAAGGCTCCCGAGTTCTGGCCCTCGCATACAAGCAGCTGA
CTGTCGACTCCGAACTGGGCACCGGCAAAATCAATGACCTAAAGCGTGAAAAGGTCGAGTGCGACCTGACTTTTG
CTGGCTTCCTTGTTCTACATTGCCCTCTCAAAGAGGACGCCAAGGAGGCCGTTCAGATGCTCAACGAGAGCAGTC
ACCGCGTGGTGATGATTACCGGAGACAACCCGCTGACTGCCGTCCACGTCGCTCGCGAGGTCGAAATAGTAGACC
GCGAGGTTCTTATCCTGGATGCGCCCGAGGACAACGCCGGCGGCCAAAAGCTCGTCTGGCGGAGCGTTGACGACA
AAGTTAGCGTTCCGGTAGACCCGTCCAAGCCTATCGATGCCGAGATCCTGCGGACGAAGGATCTCTGCGTCACGG
GATATGCCTTGGCCAAGTTCAAGGGCCAGTCTGGCTGGAACTCTCTCTTGCGACACACCTGGGTCTACGCCCGAG
TCTCCCCAAAGCAAAAGGAGGAAATCCTACTTGGTCTCAAGGACATGGGTTACTACACGCTGATGGCTGGTGACG
GCACCAACGACGTCGGAGCCCTCAAGCAGGCACATATCGGCATTGCGCTGCTGAACGGCACCAAGGACGACTTGG
CCCGCATCGCGGAACACTCCCGCAACACGAAGATGAAGGAGATGTATCAGAAGCAGTGCGATCTCATGAAGCGCT
TCAACCAGCCCACTCCACCGGTTCCGGCCATGATTGCCCATCTCTACCCCCCGGGTCCGACGAACCCCAATTACA
TGAAGGCCATCGAGCGCGAGGCTAAGAACAGGAACATGACGCCCGAAGCGTACGCCAAGGCGCAGGGCCACCCGG
CCGAGACAATTGTTTCGCCCGGTGCCCAGAGCCTGGTCAACGCCAACGACGCCCGCAGTGCCCGGCAGGCCGAGG
TGACGAAAAAGGCGGCCGGCTTCGCCGACAAGCTCACCTCGGGCATGCTCGAGGCCGAGCTTGGCGACGACGAGC
CGCCGACTCTGAAGCTGGGCGACGCCTCGGTCGCCGCGCCCTTCACGTCGAAGCTCCGAGATGTCATTGCCGTCC
CCAACATTATCCGCCAAGGCCGGTGCACCCTCGTGGCCACGATCCAGATGTACAAGATCCTCGCCCTGAACTGCC
TCATCAGCGCTTACTCGCTGTCTGTCCTGTACCTCGAGGGCATCAAGTTTGGCGATACCCAGTACACCATTAGCG
GCATGCTCATGTCGGTGTGTTTCTTGAGCATCTCCCGAGCTCGCGTGGTCGAGGGTCTCAGCAAAGAGCGCCCGC
AGCCCAACATCTTCAACGTCTACATCATCGGCTCGATACTCGGGCAGTTCGCCGTCCACATTGTCACACTCATCT
ACATTGCCCGTCTCTGTGACAAGATTGCTCCGTATGTCTCCCCCCTCTTCTTCGTCTTTCGATTTCCCGTCATAT
TGGCCCCGCTGCCGTGACTCTCCACTGACTCCGTCTGCCAGGCGCTCCACCGACAACCTCGATCTCGAGGCCGAG
TTCGAGCCATCTCTGCTGAACTCGGCCATTTACCTCCTCCAGCTCATCCAGCAGGTGTCGACGTTCGCCATCAAC
TACCAGGGCCGGCCGTTCCGCGAGTCGCTGTCGGAGAACAGGGCCATGTTCTACGGCATCGTCGGCGTCTCGGGC
CTGGCCTTCGTGTGCGCGCTGGAGCTAGTGCCCGAGATCAACGAGGGCATGAAGCTCGTCCGCTTCACCGAGGAA
TTCAAGATGAAGATGGCGGCGTGCATGGTCATCGACTACGCGCTGTGCTTCGTCATCGAGAAAGGCCTCAAAATG
GGCTTCAGCGACTACCGGCCGCGCGACATCGCGGACCGACGGCCGGAGCAGCTCGAGAGGGAGGCCGCGCGCAAG
AAGGTAATCGAGGAGAAGAAAGCGGCCGAGGAAGAGGAGAAGCGGCTGGAGAAGGTGGCCGAATTCGAGCGCCAG
GTCGAGGAGCGCAAGCGGAAGTTGCGGGAGTGGAGGGCCGGCCCCCAGCGGGCGCAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail