Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6466
Gene name
LocationContig_332:3655..4886
Strand+
Gene length (bp)1231
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain 8.7E-46 165 329
PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain 3.1E-43 20 163

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P17505|MDHM_YEAST Malate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDH1 PE=1 SV=2 4 330 8.0E-146
sp|Q9Y7R8|MDHM_SCHPO Malate dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=MDH1 PE=3 SV=1 6 330 6.0E-136
sp|Q5NVR2|MDHM_PONAB Malate dehydrogenase, mitochondrial OS=Pongo abelii GN=MDH2 PE=2 SV=1 3 329 6.0E-121
sp|P40926|MDHM_HUMAN Malate dehydrogenase, mitochondrial OS=Homo sapiens GN=MDH2 PE=1 SV=3 3 329 3.0E-119
sp|Q4R568|MDHM_MACFA Malate dehydrogenase, mitochondrial OS=Macaca fascicularis GN=MDH2 PE=2 SV=1 3 329 9.0E-119
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P17505|MDHM_YEAST Malate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDH1 PE=1 SV=2 4 330 8.0E-146
sp|Q9Y7R8|MDHM_SCHPO Malate dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=MDH1 PE=3 SV=1 6 330 6.0E-136
sp|Q5NVR2|MDHM_PONAB Malate dehydrogenase, mitochondrial OS=Pongo abelii GN=MDH2 PE=2 SV=1 3 329 6.0E-121
sp|P40926|MDHM_HUMAN Malate dehydrogenase, mitochondrial OS=Homo sapiens GN=MDH2 PE=1 SV=3 3 329 3.0E-119
sp|Q4R568|MDHM_MACFA Malate dehydrogenase, mitochondrial OS=Macaca fascicularis GN=MDH2 PE=2 SV=1 3 329 9.0E-119
sp|P08249|MDHM_MOUSE Malate dehydrogenase, mitochondrial OS=Mus musculus GN=Mdh2 PE=1 SV=3 8 329 2.0E-118
sp|Q32LG3|MDHM_BOVIN Malate dehydrogenase, mitochondrial OS=Bos taurus GN=MDH2 PE=1 SV=1 8 329 5.0E-118
sp|P04636|MDHM_RAT Malate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Mdh2 PE=1 SV=2 8 329 8.0E-118
sp|P83778|MDHC_CANAL Malate dehydrogenase, cytoplasmic OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDH1 PE=1 SV=2 18 331 2.0E-117
sp|P00346|MDHM_PIG Malate dehydrogenase, mitochondrial OS=Sus scrofa GN=MDH2 PE=1 SV=2 8 329 7.0E-116
sp|O02640|MDHM_CAEEL Probable malate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=mdh-2 PE=3 SV=1 20 332 3.0E-115
sp|Q42972|MDHG_ORYSJ Malate dehydrogenase, glyoxysomal OS=Oryza sativa subsp. japonica GN=Os12g0632700 PE=1 SV=3 20 331 5.0E-108
sp|Q9ZP06|MDHM1_ARATH Malate dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana GN=At1g53240 PE=1 SV=1 6 328 5.0E-105
sp|P83373|MDHM_FRAAN Malate dehydrogenase, mitochondrial OS=Fragaria ananassa GN=MMDHI PE=1 SV=1 4 328 5.0E-105
sp|Q9LKA3|MDHM2_ARATH Malate dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=At3g15020 PE=2 SV=1 8 328 6.0E-105
sp|Q9SN86|MDHP_ARATH Malate dehydrogenase, chloroplastic OS=Arabidopsis thaliana GN=At3g47520 PE=1 SV=1 20 326 9.0E-104
sp|P19446|MDHG_CITLA Malate dehydrogenase, glyoxysomal OS=Citrullus lanatus PE=1 SV=1 20 329 5.0E-103
sp|P37228|MDHG_SOYBN Malate dehydrogenase, glyoxysomal OS=Glycine max PE=2 SV=2 20 331 5.0E-103
sp|P46487|MDHM_EUCGU Malate dehydrogenase, mitochondrial OS=Eucalyptus gunnii GN=MDH PE=2 SV=1 8 328 1.0E-102
sp|P46488|MDHG_CUCSA Malate dehydrogenase, glyoxysomal OS=Cucumis sativus GN=MDHG PE=2 SV=1 20 329 2.0E-102
sp|P17783|MDHM_CITLA Malate dehydrogenase, mitochondrial OS=Citrullus lanatus GN=MMDH PE=1 SV=1 20 332 4.0E-102
sp|O82399|MDHG2_ARATH Probable malate dehydrogenase, glyoxysomal OS=Arabidopsis thaliana GN=At2g22780 PE=2 SV=1 20 331 9.0E-102
sp|Q42686|MDHM_CHLRE Malate dehydrogenase, mitochondrial OS=Chlamydomonas reinhardtii PE=3 SV=1 20 329 1.0E-100
sp|Q43744|MDHM_BRANA Malate dehydrogenase, mitochondrial OS=Brassica napus GN=MDH PE=2 SV=1 8 328 2.0E-98
sp|B4F2A1|MDH_PROMH Malate dehydrogenase OS=Proteus mirabilis (strain HI4320) GN=mdh PE=3 SV=1 20 331 6.0E-97
sp|Q43743|MDHG1_BRANA Malate dehydrogenase 1, glyoxysomal OS=Brassica napus GN=MDH1 PE=2 SV=2 20 331 3.0E-96
sp|A1S3C4|MDH_SHEAM Malate dehydrogenase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=mdh PE=3 SV=1 20 329 5.0E-96
sp|Q9ZP05|MDHG1_ARATH Malate dehydrogenase, glyoxysomal OS=Arabidopsis thaliana GN=At5g09660 PE=2 SV=1 20 331 7.0E-96
sp|Q9KUT3|MDH_VIBCH Malate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=mdh PE=3 SV=2 20 329 7.0E-96
sp|Q9XFW3|MDHG2_BRANA Malate dehydrogenase 2, glyoxysomal OS=Brassica napus GN=MDH2 PE=3 SV=1 20 331 1.0E-95
sp|Q57JA9|MDH_SALCH Malate dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=mdh PE=3 SV=1 20 331 2.0E-95
sp|B4T769|MDH_SALNS Malate dehydrogenase OS=Salmonella newport (strain SL254) GN=mdh PE=3 SV=1 20 331 3.0E-95
sp|P25077|MDH_SALTY Malate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdh PE=3 SV=2 20 331 5.0E-95
sp|B4TWK9|MDH_SALSV Malate dehydrogenase OS=Salmonella schwarzengrund (strain CVM19633) GN=mdh PE=3 SV=1 20 331 5.0E-95
sp|B5BGR3|MDH_SALPK Malate dehydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=mdh PE=3 SV=1 20 331 5.0E-95
sp|C0PZQ4|MDH_SALPC Malate dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=mdh PE=3 SV=1 20 331 5.0E-95
sp|A9N855|MDH_SALPB Malate dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdh PE=3 SV=1 20 331 5.0E-95
sp|Q7WS85|MDH_SALPA Malate dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdh PE=3 SV=2 20 331 5.0E-95
sp|B4TJT3|MDH_SALHS Malate dehydrogenase OS=Salmonella heidelberg (strain SL476) GN=mdh PE=3 SV=1 20 331 5.0E-95
sp|B5REV7|MDH_SALG2 Malate dehydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mdh PE=3 SV=1 20 331 5.0E-95
sp|B5R0N2|MDH_SALEP Malate dehydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=mdh PE=3 SV=1 20 331 5.0E-95
sp|B5F7L9|MDH_SALA4 Malate dehydrogenase OS=Salmonella agona (strain SL483) GN=mdh PE=3 SV=1 20 331 5.0E-95
sp|A1RFX8|MDH_SHESW Malate dehydrogenase OS=Shewanella sp. (strain W3-18-1) GN=mdh PE=3 SV=1 20 329 8.0E-95
sp|A4YAE8|MDH_SHEPC Malate dehydrogenase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=mdh PE=3 SV=1 20 329 8.0E-95
sp|Q8DEC2|MDH_VIBVU Malate dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=mdh PE=1 SV=1 20 329 8.0E-95
sp|A0L113|MDH_SHESA Malate dehydrogenase OS=Shewanella sp. (strain ANA-3) GN=mdh PE=3 SV=1 20 329 1.0E-94
sp|P82177|MDH_SHEON Malate dehydrogenase OS=Shewanella oneidensis (strain MR-1) GN=mdh PE=1 SV=2 20 329 1.0E-94
sp|A4WF48|MDH_ENT38 Malate dehydrogenase OS=Enterobacter sp. (strain 638) GN=mdh PE=3 SV=1 20 331 1.0E-94
sp|B5FIT7|MDH_SALDC Malate dehydrogenase OS=Salmonella dublin (strain CT_02021853) GN=mdh PE=3 SV=1 20 331 1.0E-94
sp|B7LRL0|MDH_ESCF3 Malate dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdh PE=3 SV=1 20 331 1.0E-94
sp|Q0HZ38|MDH_SHESR Malate dehydrogenase OS=Shewanella sp. (strain MR-7) GN=mdh PE=3 SV=1 20 329 2.0E-94
sp|Q0HEW2|MDH_SHESM Malate dehydrogenase OS=Shewanella sp. (strain MR-4) GN=mdh PE=3 SV=1 20 329 2.0E-94
sp|A7MWD3|MDH_VIBCB Malate dehydrogenase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=mdh PE=3 SV=1 20 328 2.0E-94
sp|Q87SU7|MDH_VIBPA Malate dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mdh PE=3 SV=1 20 328 2.0E-94
sp|Q8Z3E0|MDH_SALTI Malate dehydrogenase OS=Salmonella typhi GN=mdh PE=3 SV=1 20 331 2.0E-94
sp|Q6AW23|MDH_MORMI Malate dehydrogenase OS=Moritella marina GN=mdh PE=3 SV=1 20 330 2.0E-94
sp|P48364|MDH_MORS5 Malate dehydrogenase OS=Moritella sp. (strain 5710) GN=mdh PE=1 SV=1 20 330 3.0E-94
sp|A6TEQ3|MDH_KLEP7 Malate dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdh PE=3 SV=1 20 331 3.0E-94
sp|Q7MP97|MDH_VIBVY Malate dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=mdh PE=3 SV=1 20 329 4.0E-94
sp|Q6AW21|MDH_MORJA Malate dehydrogenase OS=Moritella japonica GN=mdh PE=3 SV=1 20 330 4.0E-94
sp|B5XSQ7|MDH_KLEP3 Malate dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=mdh PE=3 SV=1 20 331 7.0E-94
sp|Q12R11|MDH_SHEDO Malate dehydrogenase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=mdh PE=3 SV=1 20 329 2.0E-93
sp|A3QB91|MDH_SHELP Malate dehydrogenase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=mdh PE=3 SV=1 20 329 2.0E-93
sp|Q3YX11|MDH_SHISS Malate dehydrogenase OS=Shigella sonnei (strain Ss046) GN=mdh PE=3 SV=1 20 331 2.0E-93
sp|Q31WA4|MDH_SHIBS Malate dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=mdh PE=3 SV=1 20 331 2.0E-93
sp|B2U1U9|MDH_SHIB3 Malate dehydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdh PE=3 SV=1 20 331 2.0E-93
sp|Q1R6A3|MDH_ECOUT Malate dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=mdh PE=3 SV=2 20 331 2.0E-93
sp|P61889|MDH_ECOLI Malate dehydrogenase OS=Escherichia coli (strain K12) GN=mdh PE=1 SV=1 20 331 2.0E-93
sp|P61890|MDH_ECOL6 Malate dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdh PE=3 SV=1 20 331 2.0E-93
sp|A1AGC9|MDH_ECOK1 Malate dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=mdh PE=3 SV=1 20 331 2.0E-93
sp|A8A545|MDH_ECOHS Malate dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=mdh PE=3 SV=1 20 331 2.0E-93
sp|B1XHK9|MDH_ECODH Malate dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=mdh PE=3 SV=1 20 331 2.0E-93
sp|C4ZSX4|MDH_ECOBW Malate dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdh PE=3 SV=1 20 331 2.0E-93
sp|B7N0M1|MDH_ECO81 Malate dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=mdh PE=3 SV=1 20 331 2.0E-93
sp|B5YSW2|MDH_ECO5E Malate dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdh PE=3 SV=1 20 331 2.0E-93
sp|P61891|MDH_ECO57 Malate dehydrogenase OS=Escherichia coli O157:H7 GN=mdh PE=3 SV=1 20 331 2.0E-93
sp|B7MBZ7|MDH_ECO45 Malate dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdh PE=3 SV=1 20 331 2.0E-93
sp|B7UJW8|MDH_ECO27 Malate dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdh PE=3 SV=1 20 331 2.0E-93
sp|A7ZSD0|MDH_ECO24 Malate dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdh PE=3 SV=1 20 331 2.0E-93
sp|B1IQP3|MDH_ECOLC Malate dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdh PE=3 SV=1 20 331 2.0E-93
sp|B7M0U8|MDH_ECO8A Malate dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=mdh PE=3 SV=1 20 331 3.0E-93
sp|B7LHU4|MDH_ECO55 Malate dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=mdh PE=3 SV=1 20 331 3.0E-93
sp|Q83Q04|MDH_SHIFL Malate dehydrogenase OS=Shigella flexneri GN=mdh PE=3 SV=2 20 331 3.0E-93
sp|Q0T052|MDH_SHIF8 Malate dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=mdh PE=3 SV=1 20 331 3.0E-93
sp|Q7X3X5|MDH_MORS2 Malate dehydrogenase OS=Moritella sp. (strain 2D2) GN=mdh PE=1 SV=1 20 330 3.0E-93
sp|B1LGK2|MDH_ECOSM Malate dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdh PE=3 SV=1 20 331 3.0E-93
sp|B7NKU9|MDH_ECO7I Malate dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdh PE=3 SV=1 20 331 3.0E-93
sp|A8AQC8|MDH_CITK8 Malate dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdh PE=3 SV=1 20 331 3.0E-93
sp|Q0TCN0|MDH_ECOL5 Malate dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdh PE=3 SV=1 20 331 4.0E-93
sp|A7MNR3|MDH_CROS8 Malate dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mdh PE=3 SV=1 20 331 5.0E-93
sp|Q32BA3|MDH_SHIDS Malate dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdh PE=3 SV=1 20 331 5.0E-93
sp|B7NDL4|MDH_ECOLU Malate dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdh PE=3 SV=1 20 331 6.0E-93
sp|Q5E875|MDH_VIBF1 Malate dehydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=mdh PE=3 SV=1 20 329 6.0E-93
sp|B6I1V4|MDH_ECOSE Malate dehydrogenase OS=Escherichia coli (strain SE11) GN=mdh PE=3 SV=1 20 331 7.0E-93
sp|A8FRU0|MDH_SHESH Malate dehydrogenase OS=Shewanella sediminis (strain HAW-EB3) GN=mdh PE=3 SV=1 20 329 7.0E-93
sp|B5FGF5|MDH_VIBFM Malate dehydrogenase OS=Vibrio fischeri (strain MJ11) GN=mdh PE=3 SV=1 20 329 8.0E-93
sp|A9MNX5|MDH_SALAR Malate dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdh PE=3 SV=1 20 331 1.0E-92
sp|B8EB55|MDH_SHEB2 Malate dehydrogenase OS=Shewanella baltica (strain OS223) GN=mdh PE=3 SV=1 20 329 1.0E-92
sp|A9L340|MDH_SHEB9 Malate dehydrogenase OS=Shewanella baltica (strain OS195) GN=mdh PE=3 SV=1 20 329 2.0E-92
sp|B2VGW7|MDH_ERWT9 Malate dehydrogenase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=mdh PE=3 SV=1 20 329 2.0E-92
sp|A6WSM1|MDH_SHEB8 Malate dehydrogenase OS=Shewanella baltica (strain OS185) GN=mdh PE=3 SV=1 20 329 2.0E-92
sp|A3D075|MDH_SHEB5 Malate dehydrogenase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=mdh PE=3 SV=1 20 329 2.0E-92
sp|B1KGG7|MDH_SHEWM Malate dehydrogenase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=mdh PE=3 SV=1 20 329 4.0E-92
sp|Q6D9D1|MDH_PECAS Malate dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdh PE=3 SV=1 20 329 6.0E-92
sp|Q15YH0|MDH_PSEA6 Malate dehydrogenase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=mdh PE=3 SV=1 20 329 9.0E-92
sp|B6EL39|MDH_ALISL Malate dehydrogenase OS=Aliivibrio salmonicida (strain LFI1238) GN=mdh PE=3 SV=1 20 329 9.0E-92
sp|P37226|MDH_PHOPR Malate dehydrogenase OS=Photobacterium profundum GN=mdh PE=3 SV=2 20 331 1.0E-91
sp|B7VID0|MDH_VIBTL Malate dehydrogenase OS=Vibrio tasmaniensis (strain LGP32) GN=mdh PE=3 SV=1 20 328 1.0E-91
sp|Q5R030|MDH_IDILO Malate dehydrogenase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=mdh PE=3 SV=1 20 330 1.0E-91
sp|C6DKH1|MDH_PECCP Malate dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdh PE=3 SV=1 20 329 1.0E-91
sp|C5BF98|MDH_EDWI9 Malate dehydrogenase OS=Edwardsiella ictaluri (strain 93-146) GN=mdh PE=3 SV=1 20 331 2.0E-91
sp|A8G8Y7|MDH_SERP5 Malate dehydrogenase OS=Serratia proteamaculans (strain 568) GN=mdh PE=3 SV=1 20 329 3.0E-91
sp|Q7MYW9|MDH_PHOLL Malate dehydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=mdh PE=3 SV=1 20 329 5.0E-91
sp|A8H0U0|MDH_SHEPA Malate dehydrogenase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=mdh PE=3 SV=1 20 329 5.0E-91
sp|B0TUH8|MDH_SHEHH Malate dehydrogenase OS=Shewanella halifaxensis (strain HAW-EB4) GN=mdh PE=3 SV=1 20 329 6.0E-91
sp|A0KG16|MDH_AERHH Malate dehydrogenase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=mdh PE=3 SV=1 20 329 7.0E-91
sp|A1JIV0|MDH_YERE8 Malate dehydrogenase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdh PE=3 SV=1 20 329 1.0E-90
sp|Q07YA5|MDH_SHEFN Malate dehydrogenase OS=Shewanella frigidimarina (strain NCIMB 400) GN=mdh PE=3 SV=1 20 329 3.0E-90
sp|B1JMK1|MDH_YERPY Malate dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdh PE=3 SV=1 20 329 3.0E-90
sp|P0C7R5|MDH_YERPS Malate dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdh PE=3 SV=1 20 329 3.0E-90
sp|A4TRK3|MDH_YERPP Malate dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=mdh PE=3 SV=1 20 329 3.0E-90
sp|Q1CEJ3|MDH_YERPN Malate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdh PE=3 SV=1 20 329 3.0E-90
sp|A9R584|MDH_YERPG Malate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdh PE=3 SV=1 20 329 3.0E-90
sp|P61892|MDH_YERPE Malate dehydrogenase OS=Yersinia pestis GN=mdh PE=3 SV=1 20 329 3.0E-90
sp|B2K2N5|MDH_YERPB Malate dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdh PE=3 SV=1 20 329 3.0E-90
sp|Q1CBY7|MDH_YERPA Malate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdh PE=3 SV=1 20 329 3.0E-90
sp|A7FMU2|MDH_YERP3 Malate dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdh PE=3 SV=1 20 329 3.0E-90
sp|A4SIV0|MDH_AERS4 Malate dehydrogenase OS=Aeromonas salmonicida (strain A449) GN=mdh PE=3 SV=1 20 329 8.0E-90
sp|B8CSY7|MDH_SHEPW Malate dehydrogenase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=mdh PE=3 SV=1 20 329 1.0E-89
sp|Q9CN86|MDH_PASMU Malate dehydrogenase OS=Pasteurella multocida (strain Pm70) GN=mdh PE=3 SV=1 20 329 1.0E-88
sp|Q47VL0|MDH_COLP3 Malate dehydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=mdh PE=3 SV=1 20 330 8.0E-87
sp|B8F5K4|MDH_HAEPS Malate dehydrogenase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=mdh PE=3 SV=1 20 329 1.0E-86
sp|Q4QL89|MDH_HAEI8 Malate dehydrogenase OS=Haemophilus influenzae (strain 86-028NP) GN=mdh PE=3 SV=1 20 329 3.0E-86
sp|Q5U907|MDH_ACTSZ Malate dehydrogenase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=mdh PE=3 SV=1 20 329 3.0E-86
sp|A5UIX3|MDH_HAEIG Malate dehydrogenase OS=Haemophilus influenzae (strain PittGG) GN=mdh PE=3 SV=1 20 329 3.0E-86
sp|A5UCQ1|MDH_HAEIE Malate dehydrogenase OS=Haemophilus influenzae (strain PittEE) GN=mdh PE=3 SV=1 20 329 5.0E-86
sp|P44427|MDH_HAEIN Malate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mdh PE=3 SV=1 20 329 2.0E-85
sp|Q0I491|MDH_HAES1 Malate dehydrogenase OS=Haemophilus somnus (strain 129Pt) GN=mdh PE=3 SV=1 20 329 2.0E-84
sp|A1SRP8|MDH_PSYIN Malate dehydrogenase OS=Psychromonas ingrahamii (strain 37) GN=mdh PE=3 SV=1 20 332 3.0E-84
sp|Q65T37|MDH_MANSM Malate dehydrogenase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=mdh PE=3 SV=1 20 329 3.0E-84
sp|Q3IFH4|MDH_PSEHT Malate dehydrogenase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=mdh PE=3 SV=1 20 330 4.0E-84
sp|B0UUR6|MDH_HISS2 Malate dehydrogenase OS=Histophilus somni (strain 2336) GN=mdh PE=3 SV=1 20 329 3.0E-83
sp|Q59838|MDH_SALMU Malate dehydrogenase (Fragment) OS=Salmonella muenchen GN=mdh PE=3 SV=1 30 313 2.0E-80
sp|P32419|MDHP_YEAST Malate dehydrogenase, peroxisomal OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDH3 PE=1 SV=3 18 329 3.0E-80
sp|A3N1U6|MDH_ACTP2 Malate dehydrogenase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=mdh PE=3 SV=1 20 333 2.0E-78
sp|B0BQN0|MDH_ACTPJ Malate dehydrogenase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=mdh PE=3 SV=1 20 333 4.0E-78
sp|B3H269|MDH_ACTP7 Malate dehydrogenase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=mdh PE=3 SV=1 20 333 4.0E-78
sp|Q7VP41|MDH_HAEDU Malate dehydrogenase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=mdh PE=3 SV=1 20 333 7.0E-75
sp|Q9L8F6|MDH_VIBMI Malate dehydrogenase (Fragment) OS=Vibrio mimicus GN=mdh PE=3 SV=1 26 243 3.0E-71
sp|P61895|MDH_RAOTE Malate dehydrogenase (Fragment) OS=Raoultella terrigena GN=mdh PE=3 SV=1 54 271 2.0E-69
sp|P61896|MDH_KLEVA Malate dehydrogenase (Fragment) OS=Klebsiella variicola GN=mdh PE=3 SV=1 48 271 2.0E-69
sp|P61894|MDH_KLEOX Malate dehydrogenase (Fragment) OS=Klebsiella oxytoca GN=mdh PE=3 SV=1 54 271 8.0E-69
sp|P22133|MDHC_YEAST Malate dehydrogenase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDH2 PE=1 SV=2 20 330 3.0E-66
sp|P37227|MDHM_SCHMA Malate dehydrogenase, mitochondrial (Fragment) OS=Schistosoma mansoni PE=2 SV=1 26 168 1.0E-54
sp|P61897|MDH_PECCC Malate dehydrogenase (Fragment) OS=Pectobacterium carotovorum subsp. carotovorum GN=mdh PE=3 SV=1 99 243 4.0E-48
sp|P0C1G4|MDH_KLEPN Malate dehydrogenase (Fragments) OS=Klebsiella pneumoniae GN=mdh PE=1 SV=1 20 162 4.0E-35
sp|P0C1G5|MDH_KLEPR Malate dehydrogenase (Fragment) OS=Klebsiella pneumoniae subsp. rhinoscleromatis GN=mdh PE=3 SV=1 48 162 3.0E-29
sp|Q6L0C3|MDH_PICTO Malate dehydrogenase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=mdh PE=1 SV=1 19 332 2.0E-28
sp|C6E487|MDH_GEOSM Malate dehydrogenase OS=Geobacter sp. (strain M21) GN=mdh PE=3 SV=1 20 320 7.0E-27
sp|Q1GQY3|MDH_SPHAL Malate dehydrogenase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=mdh PE=3 SV=1 20 314 1.0E-26
sp|A5G3L2|MDH_GEOUR Malate dehydrogenase OS=Geobacter uraniireducens (strain Rf4) GN=mdh PE=3 SV=1 25 320 2.0E-26
sp|B5EIU8|MDH_GEOBB Malate dehydrogenase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=mdh PE=3 SV=1 20 320 2.0E-25
sp|B9M1D2|MDH_GEODF Malate dehydrogenase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=mdh PE=3 SV=1 20 320 2.0E-25
sp|O67655|MDH1_AQUAE Malate dehydrogenase 1 OS=Aquifex aeolicus (strain VF5) GN=mdh1 PE=3 SV=1 16 323 2.0E-25
sp|B6IYP5|MDH_RHOCS Malate dehydrogenase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=mdh PE=3 SV=1 20 323 2.0E-25
sp|A9EZV5|MDH_SORC5 Malate dehydrogenase OS=Sorangium cellulosum (strain So ce56) GN=mdh PE=3 SV=1 17 311 3.0E-25
sp|Q6ZZC6|MDH_MYXXA Malate dehydrogenase OS=Myxococcus xanthus GN=mdh PE=3 SV=1 37 322 4.0E-25
sp|Q8PVJ7|MDH_METMA Malate dehydrogenase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=mdh PE=3 SV=1 18 324 6.0E-25
sp|Q2IIC2|MDH1_ANADE Malate dehydrogenase 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=mdh1 PE=3 SV=1 20 322 1.0E-24
sp|B4U831|MDH_HYDS0 Malate dehydrogenase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=mdh PE=3 SV=1 21 331 2.0E-24
sp|B3E9R5|MDH_GEOLS Malate dehydrogenase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=mdh PE=3 SV=1 20 319 3.0E-24
sp|B1ZG93|MDH_METPB Malate dehydrogenase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=mdh PE=3 SV=1 19 319 4.0E-24
sp|A5V5U9|MDH_SPHWW Malate dehydrogenase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=mdh PE=3 SV=1 19 316 2.0E-23
sp|Q11QQ3|MDH_CYTH3 Malate dehydrogenase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=mdh PE=3 SV=1 20 312 2.0E-23
sp|A8ILC6|MDH_AZOC5 Malate dehydrogenase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=mdh PE=3 SV=1 19 331 2.0E-23
sp|Q07UX5|MDH_RHOP5 Malate dehydrogenase OS=Rhodopseudomonas palustris (strain BisA53) GN=mdh PE=3 SV=1 20 300 4.0E-23
sp|B1LZN1|MDH_METRJ Malate dehydrogenase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=mdh PE=3 SV=1 15 327 5.0E-23
sp|Q2IK16|MDH2_ANADE Malate dehydrogenase 2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=mdh2 PE=3 SV=1 19 311 5.0E-23
sp|A6WXE7|MDH_OCHA4 Malate dehydrogenase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=mdh PE=3 SV=1 15 316 5.0E-23
sp|Q3A5S0|MDH_PELCD Malate dehydrogenase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=mdh PE=3 SV=1 20 320 6.0E-23
sp|Q57AX1|MDH_BRUAB Malate dehydrogenase OS=Brucella abortus biovar 1 (strain 9-941) GN=mdh PE=3 SV=1 15 316 6.0E-23
sp|Q2YLR9|MDH_BRUA2 Malate dehydrogenase OS=Brucella abortus (strain 2308) GN=mdh PE=1 SV=1 15 316 6.0E-23
sp|B2S881|MDH_BRUA1 Malate dehydrogenase OS=Brucella abortus (strain S19) GN=mdh PE=3 SV=1 15 316 6.0E-23
sp|Q2GCH6|MDH_NEOSM Malate dehydrogenase OS=Neorickettsia sennetsu (strain Miyayama) GN=mdh PE=3 SV=1 20 300 8.0E-23
sp|P80458|MDH_RHOPA Malate dehydrogenase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=mdh PE=1 SV=2 20 300 9.0E-23
sp|B3Q761|MDH_RHOPT Malate dehydrogenase OS=Rhodopseudomonas palustris (strain TIE-1) GN=mdh PE=3 SV=1 20 300 9.0E-23
sp|Q0AKT3|MDH_MARMM Malate dehydrogenase OS=Maricaulis maris (strain MCS10) GN=mdh PE=3 SV=1 15 327 1.0E-22
sp|B8GPC3|MDH_THISH Malate dehydrogenase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=mdh PE=3 SV=1 18 233 1.0E-22
sp|Q2G946|MDH_NOVAD Malate dehydrogenase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=mdh PE=3 SV=1 20 316 1.0E-22
sp|Q39VY0|MDH_GEOMG Malate dehydrogenase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=mdh PE=3 SV=1 20 319 1.0E-22
sp|A7HT37|MDH_PARL1 Malate dehydrogenase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=mdh PE=3 SV=1 20 309 1.0E-22
sp|B2IG85|MDH_BEII9 Malate dehydrogenase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=mdh PE=3 SV=1 15 308 2.0E-22
sp|Q4FP28|MDH_PELUB Malate dehydrogenase OS=Pelagibacter ubique (strain HTCC1062) GN=mdh PE=3 SV=1 18 309 2.0E-22
sp|Q9ZDF3|MDH_RICPR Malate dehydrogenase OS=Rickettsia prowazekii (strain Madrid E) GN=mdh PE=3 SV=1 20 256 2.0E-22
sp|A5VSQ4|MDH_BRUO2 Malate dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=mdh PE=3 SV=1 15 316 2.0E-22
sp|C0RFH2|MDH_BRUMB Malate dehydrogenase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=mdh PE=3 SV=1 15 316 2.0E-22
sp|A8EZ58|MDH_RICCK Malate dehydrogenase OS=Rickettsia canadensis (strain McKiel) GN=mdh PE=3 SV=1 20 256 3.0E-22
sp|Q979N9|MDH_THEVO Malate dehydrogenase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=mdh PE=3 SV=1 20 300 3.0E-22
sp|Q74D53|MDH_GEOSL Malate dehydrogenase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mdh PE=3 SV=1 20 319 4.0E-22
sp|Q9HJL5|MDH_THEAC Malate dehydrogenase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=mdh PE=3 SV=1 20 332 4.0E-22
sp|Q46BQ2|MDH_METBF Malate dehydrogenase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=mdh PE=3 SV=1 18 324 4.0E-22
sp|Q5WEG2|MDH_BACSK Malate dehydrogenase OS=Bacillus clausii (strain KSM-K16) GN=mdh PE=3 SV=1 20 333 6.0E-22
sp|Q6FYD0|MDH_BARQU Malate dehydrogenase OS=Bartonella quintana (strain Toulouse) GN=mdh PE=3 SV=1 20 320 6.0E-22
sp|A7Z7J8|MDH_BACMF Malate dehydrogenase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=mdh PE=3 SV=1 16 324 8.0E-22
sp|Q6G1M0|MDH_BARHE Malate dehydrogenase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=mdh PE=3 SV=1 20 315 8.0E-22
sp|Q49VN8|MDH_STAS1 Malate dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=mdh PE=3 SV=1 20 256 9.0E-22
sp|Q5GT41|MDH_WOLTR Malate dehydrogenase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=mdh PE=3 SV=1 20 320 1.0E-21
sp|Q8EPE2|MDH_OCEIH Malate dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=mdh PE=3 SV=1 20 256 1.0E-21
sp|Q8FYF4|MDH_BRUSU Malate dehydrogenase OS=Brucella suis biovar 1 (strain 1330) GN=mdh PE=3 SV=1 15 316 1.0E-21
sp|A9M8R3|MDH_BRUC2 Malate dehydrogenase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=mdh PE=3 SV=1 15 316 1.0E-21
sp|A7IBL9|MDH_XANP2 Malate dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=mdh PE=3 SV=1 15 315 2.0E-21
sp|A9W386|MDH_METEP Malate dehydrogenase OS=Methylobacterium extorquens (strain PA1) GN=mdh PE=1 SV=1 19 300 2.0E-21
sp|Q84FY8|MDH_METEA Malate dehydrogenase OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=mdh PE=3 SV=2 19 300 2.0E-21
sp|B7KVX2|MDH_METC4 Malate dehydrogenase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=mdh PE=3 SV=1 19 300 2.0E-21
sp|Q2RV34|MDH_RHORT Malate dehydrogenase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=mdh PE=3 SV=1 20 230 2.0E-21
sp|Q8YJE7|MDH_BRUME Malate dehydrogenase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=mdh PE=3 SV=2 15 316 2.0E-21
sp|Q13DR6|MDH_RHOPS Malate dehydrogenase OS=Rhodopseudomonas palustris (strain BisB5) GN=mdh PE=3 SV=1 20 300 2.0E-21
sp|B0CIT1|MDH_BRUSI Malate dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=mdh PE=3 SV=1 15 316 2.0E-21
sp|Q2J3G8|MDH_RHOP2 Malate dehydrogenase OS=Rhodopseudomonas palustris (strain HaA2) GN=mdh PE=3 SV=1 20 300 2.0E-21
sp|A8GWI0|MDH_RICB8 Malate dehydrogenase OS=Rickettsia bellii (strain OSU 85-389) GN=mdh PE=3 SV=1 20 323 2.0E-21
sp|A8GN82|MDH_RICAH Malate dehydrogenase OS=Rickettsia akari (strain Hartford) GN=mdh PE=3 SV=1 20 230 3.0E-21
sp|B8IJB4|MDH_METNO Malate dehydrogenase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=mdh PE=3 SV=1 20 316 3.0E-21
sp|Q1RIT9|MDH_RICBR Malate dehydrogenase OS=Rickettsia bellii (strain RML369-C) GN=mdh PE=3 SV=1 20 323 4.0E-21
sp|Q68WZ8|MDH_RICTY Malate dehydrogenase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=mdh PE=3 SV=1 20 230 5.0E-21
sp|A4J5N8|MDH_DESRM Malate dehydrogenase OS=Desulfotomaculum reducens (strain MI-1) GN=mdh PE=3 SV=1 71 324 5.0E-21
sp|Q65G89|MDH_BACLD Malate dehydrogenase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=mdh PE=3 SV=1 19 324 5.0E-21
sp|Q2RHG3|LDH_MOOTA L-lactate dehydrogenase OS=Moorella thermoacetica (strain ATCC 39073) GN=ldh PE=3 SV=1 19 300 6.0E-21
sp|Q2W064|MDH_MAGSA Malate dehydrogenase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=mdh PE=3 SV=1 20 308 7.0E-21
sp|C0R4Y0|MDH_WOLWR Malate dehydrogenase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=mdh PE=3 SV=1 20 320 7.0E-21
sp|Q73G44|MDH_WOLPM Malate dehydrogenase OS=Wolbachia pipientis wMel GN=mdh PE=3 SV=1 20 320 7.0E-21
sp|B0UCF0|MDH_METS4 Malate dehydrogenase OS=Methylobacterium sp. (strain 4-46) GN=mdh PE=3 SV=1 20 327 8.0E-21
sp|Q3MDN9|MDH_ANAVT Malate dehydrogenase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=mdh PE=3 SV=1 87 324 9.0E-21
sp|B0TZT2|MDH_FRAP2 Malate dehydrogenase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=mdh PE=3 SV=1 20 320 9.0E-21
sp|Q5HR46|MDH_STAEQ Malate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=mdh PE=3 SV=1 17 246 9.0E-21
sp|Q8CQ25|MDH_STAES Malate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mdh PE=3 SV=1 17 246 1.0E-20
sp|A9VJQ4|MDH_BACWK Malate dehydrogenase OS=Bacillus weihenstephanensis (strain KBAB4) GN=mdh PE=3 SV=1 20 300 1.0E-20
sp|A9IZV5|MDH_BART1 Malate dehydrogenase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=mdh PE=3 SV=1 20 315 1.0E-20
sp|A7GTN7|MDH_BACCN Malate dehydrogenase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mdh PE=3 SV=1 20 300 1.0E-20
sp|B0TCL9|MDH_HELMI Malate dehydrogenase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=mdh PE=3 SV=1 20 322 1.0E-20
sp|Q21CW7|MDH1_RHOPB Malate dehydrogenase 1 OS=Rhodopseudomonas palustris (strain BisB18) GN=mdh1 PE=3 SV=1 20 300 1.0E-20
sp|A8FG47|MDH_BACP2 Malate dehydrogenase OS=Bacillus pumilus (strain SAFR-032) GN=mdh PE=3 SV=1 15 296 1.0E-20
sp|A8LJK6|MDH_DINSH Malate dehydrogenase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=mdh PE=3 SV=1 20 256 2.0E-20
sp|Q9K849|MDH_BACHD Malate dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mdh PE=3 SV=1 20 309 2.0E-20
sp|P49814|MDH_BACSU Malate dehydrogenase OS=Bacillus subtilis (strain 168) GN=mdh PE=1 SV=3 20 324 2.0E-20
sp|B3CM44|MDH_WOLPP Malate dehydrogenase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=mdh PE=3 SV=1 20 323 2.0E-20
sp|C4K2E2|MDH_RICPU Malate dehydrogenase OS=Rickettsia peacockii (strain Rustic) GN=mdh PE=3 SV=1 20 323 2.0E-20
sp|B9JTS9|MDH_AGRVS Malate dehydrogenase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=mdh PE=3 SV=1 15 316 2.0E-20
sp|Q89X59|MDH_BRADU Malate dehydrogenase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mdh PE=3 SV=1 20 300 4.0E-20
sp|Q4ULY2|MDH_RICFE Malate dehydrogenase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=mdh PE=3 SV=1 20 230 5.0E-20
sp|P93052|LDH_BOTBR L-lactate dehydrogenase OS=Botryococcus braunii PE=1 SV=1 20 316 5.0E-20
sp|Q55383|MDH_SYNY3 Malate dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mdh PE=3 SV=1 20 300 6.0E-20
sp|A4WNM7|MDH_RHOS5 Malate dehydrogenase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=mdh PE=3 SV=1 20 311 6.0E-20
sp|A1UQV8|MDH_BARBK Malate dehydrogenase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=mdh PE=3 SV=1 20 300 7.0E-20
sp|A0Q6K3|MDH_FRATN Malate dehydrogenase OS=Francisella tularensis subsp. novicida (strain U112) GN=mdh PE=3 SV=1 20 297 7.0E-20
sp|Q8GNM0|MDH_FRANO Malate dehydrogenase OS=Francisella novicida GN=mdh PE=3 SV=1 20 297 7.0E-20
sp|Q169U9|MDH_ROSDO Malate dehydrogenase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=mdh PE=3 SV=1 20 300 7.0E-20
sp|A6UDP3|MDH_SINMW Malate dehydrogenase OS=Sinorhizobium medicae (strain WSM419) GN=mdh PE=3 SV=1 15 300 8.0E-20
sp|A5VY92|MDH_PSEP1 Malate dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=mdh PE=3 SV=1 18 254 8.0E-20
sp|Q8A0W0|MDH_BACTN Malate dehydrogenase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=mdh PE=3 SV=1 18 300 8.0E-20
sp|Q6HCU0|MDH_BACHK Malate dehydrogenase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mdh PE=3 SV=1 20 300 9.0E-20
sp|B9J092|MDH_BACCQ Malate dehydrogenase OS=Bacillus cereus (strain Q1) GN=mdh PE=3 SV=1 20 300 9.0E-20
sp|B7HRN2|MDH_BACC7 Malate dehydrogenase OS=Bacillus cereus (strain AH187) GN=mdh PE=3 SV=1 20 300 9.0E-20
sp|B7HFA6|MDH_BACC4 Malate dehydrogenase OS=Bacillus cereus (strain B4264) GN=mdh PE=3 SV=1 20 300 9.0E-20
sp|C1EUT6|MDH_BACC3 Malate dehydrogenase OS=Bacillus cereus (strain 03BB102) GN=mdh PE=3 SV=1 20 300 9.0E-20
sp|B7IJZ0|MDH_BACC2 Malate dehydrogenase OS=Bacillus cereus (strain G9842) GN=mdh PE=3 SV=1 20 300 9.0E-20
sp|Q72ZE5|MDH_BACC1 Malate dehydrogenase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mdh PE=3 SV=1 20 300 9.0E-20
sp|B7JRW5|MDH_BACC0 Malate dehydrogenase OS=Bacillus cereus (strain AH820) GN=mdh PE=3 SV=1 20 300 9.0E-20
sp|Q6HSF4|MDH_BACAN Malate dehydrogenase OS=Bacillus anthracis GN=mdh PE=1 SV=1 20 300 9.0E-20
sp|A0RJJ0|MDH_BACAH Malate dehydrogenase OS=Bacillus thuringiensis (strain Al Hakam) GN=mdh PE=3 SV=1 20 300 9.0E-20
sp|C3L8X1|MDH_BACAC Malate dehydrogenase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=mdh PE=3 SV=1 20 300 9.0E-20
sp|C3PAI1|MDH_BACAA Malate dehydrogenase OS=Bacillus anthracis (strain A0248) GN=mdh PE=3 SV=1 20 300 9.0E-20
sp|Q817F9|MDH_BACCR Malate dehydrogenase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mdh PE=3 SV=1 20 300 9.0E-20
sp|Q633K5|MDH_BACCZ Malate dehydrogenase OS=Bacillus cereus (strain ZK / E33L) GN=mdh PE=3 SV=1 20 300 9.0E-20
sp|Q9EYJ6|MDH_RHIME Malate dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=mdh PE=3 SV=1 15 230 1.0E-19
sp|Q92IA0|MDH_RICCN Malate dehydrogenase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=mdh PE=3 SV=1 19 323 1.0E-19
sp|Q5PAV3|MDH_ANAMM Malate dehydrogenase OS=Anaplasma marginale (strain St. Maries) GN=mdh PE=3 SV=1 19 298 1.0E-19
sp|B2J5F8|MDH_NOSP7 Malate dehydrogenase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=mdh PE=3 SV=1 15 331 1.0E-19
sp|Q11CV9|MDH_CHESB Malate dehydrogenase OS=Chelativorans sp. (strain BNC1) GN=mdh PE=3 SV=1 20 312 1.0E-19
sp|A8GRV2|MDH_RICRS Malate dehydrogenase OS=Rickettsia rickettsii (strain Sheila Smith) GN=mdh PE=3 SV=1 20 323 1.0E-19
sp|B0BXA8|MDH_RICRO Malate dehydrogenase OS=Rickettsia rickettsii (strain Iowa) GN=mdh PE=3 SV=1 20 323 1.0E-19
sp|Q64P62|MDH_BACFR Malate dehydrogenase OS=Bacteroides fragilis (strain YCH46) GN=mdh PE=3 SV=1 18 300 2.0E-19
sp|Q5L8Z8|MDH_BACFN Malate dehydrogenase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=mdh PE=3 SV=1 18 300 2.0E-19
sp|Q5LXE1|MDH_RUEPO Malate dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=mdh PE=3 SV=1 20 256 2.0E-19
sp|B9KIH0|MDH_ANAMF Malate dehydrogenase OS=Anaplasma marginale (strain Florida) GN=mdh PE=3 SV=1 19 298 2.0E-19
sp|B9KZS7|MDH_THERP Malate dehydrogenase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=mdh PE=3 SV=1 20 309 2.0E-19
sp|A4IY35|MDH_FRATW Malate dehydrogenase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=mdh PE=3 SV=1 20 331 2.0E-19
sp|Q14IT0|MDH_FRAT1 Malate dehydrogenase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=mdh PE=3 SV=1 20 331 2.0E-19
sp|Q67LB8|MDH_SYMTH Malate dehydrogenase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=mdh PE=3 SV=1 20 309 2.0E-19
sp|B9KNB4|MDH_RHOSK Malate dehydrogenase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=mdh PE=3 SV=1 20 327 2.0E-19
sp|Q3IZ83|MDH_RHOS4 Malate dehydrogenase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mdh PE=3 SV=2 20 327 2.0E-19
sp|A3PN14|MDH_RHOS1 Malate dehydrogenase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=mdh PE=3 SV=1 20 327 2.0E-19
sp|Q3YS64|MDH_EHRCJ Malate dehydrogenase OS=Ehrlichia canis (strain Jake) GN=mdh PE=3 SV=1 20 309 2.0E-19
sp|C3M9U0|MDH_RHISN Malate dehydrogenase OS=Rhizobium sp. (strain NGR234) GN=mdh PE=3 SV=1 15 316 2.0E-19
sp|Q98EC4|MDH_RHILO Malate dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=mdh PE=3 SV=1 15 313 2.0E-19
sp|Q2A3K7|MDH_FRATH Malate dehydrogenase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=mdh PE=3 SV=1 20 297 2.0E-19
sp|A7NC13|MDH_FRATF Malate dehydrogenase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=mdh PE=3 SV=2 20 297 2.0E-19
sp|A8EUE8|MDH_ARCB4 Malate dehydrogenase OS=Arcobacter butzleri (strain RM4018) GN=mdh PE=3 SV=1 17 310 2.0E-19
sp|Q5HBC0|MDH_EHRRW Malate dehydrogenase OS=Ehrlichia ruminantium (strain Welgevonden) GN=mdh PE=3 SV=2 20 309 2.0E-19
sp|Q1QQR2|MDH_NITHX Malate dehydrogenase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=mdh PE=3 SV=1 20 300 3.0E-19
sp|B2SH29|MDH_FRATM Malate dehydrogenase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=mdh PE=3 SV=1 20 297 3.0E-19
sp|A6L903|MDH_PARD8 Malate dehydrogenase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=mdh PE=3 SV=1 18 311 3.0E-19
sp|Q9X4K8|MDH_GEOTD Malate dehydrogenase OS=Geobacillus thermodenitrificans GN=mdh PE=3 SV=1 20 300 3.0E-19
sp|Q5FGT9|MDH_EHRRG Malate dehydrogenase OS=Ehrlichia ruminantium (strain Gardel) GN=mdh PE=3 SV=1 20 309 3.0E-19
sp|Q8TSH7|MDH_METAC Malate dehydrogenase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=mdh PE=3 SV=1 18 293 4.0E-19
sp|Q5KWB7|MDH_GEOKA Malate dehydrogenase OS=Geobacillus kaustophilus (strain HTA426) GN=mdh PE=3 SV=1 20 309 4.0E-19
sp|C3PN92|MDH_RICAE Malate dehydrogenase OS=Rickettsia africae (strain ESF-5) GN=mdh PE=3 SV=1 20 274 4.0E-19
sp|C5D654|MDH_GEOSW Malate dehydrogenase OS=Geobacillus sp. (strain WCH70) GN=mdh PE=3 SV=1 20 309 5.0E-19
sp|P80039|MDH_CHLTE Malate dehydrogenase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=mdh PE=1 SV=3 20 312 5.0E-19
sp|A4IRP9|MDH_GEOTN Malate dehydrogenase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mdh PE=3 SV=1 20 300 5.0E-19
sp|B0KMD1|MDH_PSEPG Malate dehydrogenase OS=Pseudomonas putida (strain GB-1) GN=mdh PE=3 SV=1 18 254 5.0E-19
sp|B4SFQ8|MDH_PELPB Malate dehydrogenase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=mdh PE=3 SV=1 20 323 6.0E-19
sp|Q8YP78|MDH_NOSS1 Malate dehydrogenase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=mdh PE=3 SV=2 87 324 7.0E-19
sp|Q3SVK5|MDH_NITWN Malate dehydrogenase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=mdh PE=3 SV=1 20 300 8.0E-19
sp|B7GGT8|MDH_ANOFW Malate dehydrogenase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=mdh PE=3 SV=1 20 309 1.0E-18
sp|A6Q388|MDH_NITSB Malate dehydrogenase OS=Nitratiruptor sp. (strain SB155-2) GN=mdh PE=3 SV=1 19 322 1.0E-18
sp|A5E935|MDH_BRASB Malate dehydrogenase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=mdh PE=3 SV=1 20 300 1.0E-18
sp|Q2K3E9|MDH_RHIEC Malate dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=mdh PE=3 SV=1 15 300 1.0E-18
sp|B3PQ91|MDH_RHIE6 Malate dehydrogenase OS=Rhizobium etli (strain CIAT 652) GN=mdh PE=3 SV=1 15 300 1.0E-18
sp|Q2S289|MDH_SALRD Malate dehydrogenase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=mdh PE=1 SV=1 20 323 2.0E-18
sp|Q30RQ5|MDH_SULDN Malate dehydrogenase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=mdh PE=3 SV=1 20 322 2.0E-18
sp|B0T6C1|MDH_CAUSK Malate dehydrogenase OS=Caulobacter sp. (strain K31) GN=mdh PE=3 SV=1 19 313 2.0E-18
sp|Q59202|MDH_BACIS Malate dehydrogenase OS=Bacillus israeli GN=mdh PE=3 SV=1 20 309 2.0E-18
sp|B1LAF5|LDH_THESQ L-lactate dehydrogenase OS=Thermotoga sp. (strain RQ2) GN=ldh PE=3 SV=1 20 310 2.0E-18
sp|B5ZSS0|MDH_RHILW Malate dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=mdh PE=3 SV=1 15 316 2.0E-18
sp|O33525|MDH_RHIL3 Malate dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=mdh PE=3 SV=1 15 316 2.0E-18
sp|A5FHP3|MDH_FLAJ1 Malate dehydrogenase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=mdh PE=3 SV=1 20 313 3.0E-18
sp|A4SFT4|MDH_CHLPM Malate dehydrogenase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=mdh PE=3 SV=1 20 323 3.0E-18
sp|B8EM38|MDH_METSB Malate dehydrogenase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=mdh PE=3 SV=1 19 311 4.0E-18
sp|Q7CWK7|MDH_AGRFC Malate dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mdh PE=3 SV=2 20 316 4.0E-18
sp|O08349|MDH_ARCFU Malate dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=mdh PE=1 SV=1 27 295 4.0E-18
sp|A4YKC5|MDH_BRASO Malate dehydrogenase OS=Bradyrhizobium sp. (strain ORS278) GN=mdh PE=3 SV=1 20 231 4.0E-18
sp|Q3B2R4|MDH_CHLL7 Malate dehydrogenase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=mdh PE=3 SV=1 20 321 5.0E-18
sp|Q7VFV4|MDH_HELHP Malate dehydrogenase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=mdh PE=3 SV=1 18 323 7.0E-18
sp|Q28U77|MDH_JANSC Malate dehydrogenase OS=Jannaschia sp. (strain CCS1) GN=mdh PE=3 SV=1 20 300 1.0E-17
sp|B9DK67|MDH_STACT Malate dehydrogenase OS=Staphylococcus carnosus (strain TM300) GN=mdh PE=3 SV=1 19 300 3.0E-17
sp|Q88Q44|MDH_PSEPK Probable malate dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=mdh PE=3 SV=1 54 254 4.0E-17
sp|B1I3T1|MDH_DESAP Malate dehydrogenase OS=Desulforudis audaxviator (strain MP104C) GN=mdh PE=3 SV=1 20 256 4.0E-17
sp|Q2GGI2|MDH_EHRCR Malate dehydrogenase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=mdh PE=3 SV=1 20 309 4.0E-17
sp|Q3Z9A4|MDH_DEHM1 Malate dehydrogenase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=mdh PE=3 SV=1 18 322 4.0E-17
sp|A1BHN9|MDH_CHLPD Malate dehydrogenase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=mdh PE=3 SV=1 20 300 7.0E-17
sp|A5IL75|LDH_THEP1 L-lactate dehydrogenase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=ldh PE=3 SV=1 20 297 9.0E-17
sp|P16115|LDH_THEMA L-lactate dehydrogenase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ldh PE=1 SV=2 20 297 9.0E-17
sp|Q2GK85|MDH_ANAPZ Malate dehydrogenase OS=Anaplasma phagocytophilum (strain HZ) GN=mdh PE=3 SV=1 20 298 1.0E-16
sp|Q7UNC6|MDH_RHOBA Malate dehydrogenase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=mdh PE=3 SV=1 88 312 1.0E-16
sp|B9JCF5|MDH_AGRRK Malate dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=mdh PE=3 SV=1 15 230 1.0E-16
sp|Q6A9C3|LDH_PROAC L-lactate dehydrogenase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=ldh PE=3 SV=2 14 313 2.0E-16
sp|B9LLP6|MDH_CHLSY Malate dehydrogenase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=mdh PE=3 SV=1 20 314 2.0E-16
sp|Q3J7E7|MDH_NITOC Malate dehydrogenase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=mdh PE=3 SV=1 18 233 2.0E-16
sp|B3QPY9|MDH_CHLP8 Malate dehydrogenase OS=Chlorobaculum parvum (strain NCIB 8327) GN=mdh PE=1 SV=1 88 312 2.0E-16
sp|Q3AS98|MDH_CHLCH Malate dehydrogenase OS=Chlorobium chlorochromatii (strain CaD3) GN=mdh PE=3 SV=1 88 323 2.0E-16
sp|B3QSH8|MDH_CHLT3 Malate dehydrogenase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=mdh PE=3 SV=1 87 324 2.0E-16
sp|Q7X5C9|LDH_THESW L-lactate dehydrogenase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) GN=ldh PE=3 SV=2 18 313 3.0E-16
sp|P0C890|MDH_PROVB Malate dehydrogenase OS=Prosthecochloris vibrioformis GN=mdh PE=1 SV=1 88 312 3.0E-16
sp|Q3ZZJ7|MDH_DEHMC Malate dehydrogenase OS=Dehalococcoides mccartyi (strain CBDB1) GN=mdh PE=3 SV=1 18 313 3.0E-16
sp|A5UPY6|MDH_ROSS1 Malate dehydrogenase OS=Roseiflexus sp. (strain RS-1) GN=mdh PE=3 SV=1 71 300 4.0E-16
sp|A5FS18|MDH_DEHMB Malate dehydrogenase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=mdh PE=3 SV=1 18 322 5.0E-16
sp|Q9A2B1|MDH_CAUCR Malate dehydrogenase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=mdh PE=3 SV=1 19 298 6.0E-16
sp|B8GVT2|MDH_CAUCN Malate dehydrogenase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=mdh PE=3 SV=1 19 298 6.0E-16
sp|B8GDA2|MDH_CHLAD Malate dehydrogenase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=mdh PE=3 SV=1 88 314 6.0E-16
sp|P80040|MDH_CHLAA Malate dehydrogenase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=mdh PE=1 SV=3 20 314 7.0E-16
sp|Q60176|MDH_METJA Malate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=mdh PE=1 SV=1 20 236 1.0E-15
sp|Q7NHJ3|MDH_GLOVI Malate dehydrogenase OS=Gloeobacter violaceus (strain PCC 7421) GN=mdh PE=3 SV=1 19 335 1.0E-15
sp|B3EEE5|MDH_CHLL2 Malate dehydrogenase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=mdh PE=3 SV=1 20 300 1.0E-15
sp|A4J898|LDH_DESRM L-lactate dehydrogenase OS=Desulfotomaculum reducens (strain MI-1) GN=ldh PE=3 SV=1 16 300 2.0E-15
sp|Q20XN0|MDH2_RHOPB Malate dehydrogenase 2 OS=Rhodopseudomonas palustris (strain BisB18) GN=mdh2 PE=3 SV=1 23 230 3.0E-15
sp|O67581|MDH2_AQUAE Malate dehydrogenase 2 OS=Aquifex aeolicus (strain VF5) GN=mdh2 PE=3 SV=1 20 255 3.0E-15
sp|A7NG29|MDH_ROSCS Malate dehydrogenase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=mdh PE=3 SV=1 71 300 4.0E-15
sp|B3EP06|MDH_CHLPB Malate dehydrogenase OS=Chlorobium phaeobacteroides (strain BS1) GN=mdh PE=3 SV=1 88 321 6.0E-15
sp|Q892U0|LDH_CLOTE L-lactate dehydrogenase OS=Clostridium tetani (strain Massachusetts / E88) GN=ldh PE=3 SV=2 20 324 7.0E-15
sp|Q0BXA0|MDH_HYPNA Malate dehydrogenase OS=Hyphomonas neptunium (strain ATCC 15444) GN=mdh PE=3 SV=1 15 255 1.0E-14
sp|Q27797|LDH_TOXGO L-lactate dehydrogenase OS=Toxoplasma gondii PE=1 SV=1 20 315 2.0E-14
sp|Q7M9A7|MDH_WOLSU Malate dehydrogenase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=mdh PE=3 SV=1 27 256 3.0E-14
sp|P22988|LDHA_HORVU L-lactate dehydrogenase A OS=Hordeum vulgare PE=1 SV=1 16 312 4.0E-14
sp|B1IKX1|LDH_CLOBK L-lactate dehydrogenase OS=Clostridium botulinum (strain Okra / Type B1) GN=ldh PE=3 SV=1 16 314 5.0E-14
sp|A5I1Z6|LDH_CLOBH L-lactate dehydrogenase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=ldh PE=3 SV=1 16 314 1.0E-13
sp|A7FU32|LDH_CLOB1 L-lactate dehydrogenase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=ldh PE=3 SV=1 16 314 1.0E-13
sp|Q8XP62|LDH_CLOPE L-lactate dehydrogenase OS=Clostridium perfringens (strain 13 / Type A) GN=ldh PE=3 SV=1 19 256 1.0E-13
sp|Q0TUX8|LDH_CLOP1 L-lactate dehydrogenase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ldh PE=3 SV=1 19 256 1.0E-13
sp|A7GDK3|LDH_CLOBL L-lactate dehydrogenase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=ldh PE=3 SV=1 16 314 1.0E-13
sp|C1FMZ1|LDH_CLOBJ L-lactate dehydrogenase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=ldh PE=3 SV=1 16 314 1.0E-13
sp|Q0SWR1|LDH_CLOPS L-lactate dehydrogenase OS=Clostridium perfringens (strain SM101 / Type A) GN=ldh PE=3 SV=1 19 256 1.0E-13
sp|Q2NGI3|MDH_METST Malate dehydrogenase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=mdh PE=3 SV=1 18 207 2.0E-13
sp|C3KVF0|LDH_CLOB6 L-lactate dehydrogenase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=ldh PE=3 SV=1 16 314 2.0E-13
sp|P22989|LDHB_HORVU L-lactate dehydrogenase B (Fragment) OS=Hordeum vulgare PE=1 SV=1 6 312 3.0E-13
sp|Q8KQC4|LDH_CLOTH L-lactate dehydrogenase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ldh PE=3 SV=2 18 328 3.0E-13
sp|Q07841|MDH_HALMA Malate dehydrogenase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=mdh PE=1 SV=1 57 311 4.0E-13
sp|P00343|LDH_LACCA L-lactate dehydrogenase OS=Lactobacillus casei GN=ldh PE=1 SV=3 83 332 4.0E-13
sp|B4S9F1|MDH_PROA2 Malate dehydrogenase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=mdh PE=3 SV=1 88 314 5.0E-13
sp|Q9P9L2|MDH_HALVD Malate dehydrogenase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=mdh PE=1 SV=2 57 324 5.0E-13
sp|Q5FMB0|LDH1_LACAC L-lactate dehydrogenase 1 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=ldh1 PE=3 SV=1 82 327 5.0E-13
sp|Q6LZI3|MDH_METMP Malate dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=mdh PE=3 SV=1 21 300 9.0E-13
sp|B1L1N3|LDH_CLOBM L-lactate dehydrogenase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=ldh PE=3 SV=1 16 314 9.0E-13
sp|B3QX21|LDH_CHLT3 L-lactate dehydrogenase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=ldh PE=3 SV=1 20 256 1.0E-12
sp|Q8TWG5|MDH_METKA Malate dehydrogenase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=mdh PE=3 SV=1 18 300 1.0E-12
sp|Q7NG49|LDH_GLOVI L-lactate dehydrogenase OS=Gloeobacter violaceus (strain PCC 7421) GN=ldh PE=3 SV=1 1 297 1.0E-12
sp|Q816G3|LDH2_BACCR L-lactate dehydrogenase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ldh2 PE=3 SV=1 16 255 2.0E-12
sp|D8KFT1|LDH2_LACLN L-lactate dehydrogenase 2 OS=Lactococcus lactis subsp. cremoris (strain NZ9000) GN=ldhB PE=1 SV=1 20 323 2.0E-12
sp|P0CI34|LDH2_LACLM L-lactate dehydrogenase 2 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=ldhB PE=3 SV=1 20 323 2.0E-12
sp|P0C2T6|LDH2_LACLC L-lactate dehydrogenase 2 OS=Lactococcus lactis subsp. cremoris GN=ldhB PE=3 SV=1 20 323 2.0E-12
sp|P14561|LDHP_BACPS L-lactate dehydrogenase P OS=Bacillus psychrosaccharolyticus GN=ldhP PE=1 SV=1 16 255 2.0E-12
sp|Q97MD1|LDH1_CLOAB L-lactate dehydrogenase 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=ldh1 PE=3 SV=1 19 256 3.0E-12
sp|C5CGP2|LDH_KOSOT L-lactate dehydrogenase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=ldh PE=3 SV=1 20 300 3.0E-12
sp|Q27743|LDH_PLAFD L-lactate dehydrogenase OS=Plasmodium falciparum (isolate CDC / Honduras) PE=1 SV=1 23 320 3.0E-12
sp|Q9CII4|LDH2_LACLA L-lactate dehydrogenase 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ldhB PE=3 SV=1 20 323 3.0E-12
sp|P62048|LDH2_BACC1 L-lactate dehydrogenase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ldh2 PE=3 SV=1 16 207 5.0E-12
sp|Q6HC14|LDH2_BACHK L-lactate dehydrogenase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ldh2 PE=3 SV=1 16 207 5.0E-12
sp|Q632G8|LDH2_BACCZ L-lactate dehydrogenase 2 OS=Bacillus cereus (strain ZK / E33L) GN=ldh2 PE=3 SV=1 16 207 5.0E-12
sp|Q81K80|LDH2_BACAN L-lactate dehydrogenase 2 OS=Bacillus anthracis GN=ldh2 PE=3 SV=1 16 207 5.0E-12
sp|Q5R5F0|LDHA_PONAB L-lactate dehydrogenase A chain OS=Pongo abelii GN=LDHA PE=2 SV=3 19 328 5.0E-12
sp|P78007|LDH_MYCPN L-lactate dehydrogenase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ldh PE=3 SV=1 74 323 5.0E-12
sp|Q2JRH2|LDH_SYNJA L-lactate dehydrogenase OS=Synechococcus sp. (strain JA-3-3Ab) GN=ldh PE=3 SV=1 27 310 6.0E-12
sp|O26290|MDH_METTH Malate dehydrogenase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=mdh PE=3 SV=1 20 329 6.0E-12
sp|A8MAC1|MDH_CALMQ Malate dehydrogenase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=mdh PE=3 SV=1 85 324 6.0E-12
sp|Q9BE24|LDHA_MACFA L-lactate dehydrogenase A chain OS=Macaca fascicularis GN=LDHA PE=2 SV=4 19 328 6.0E-12
sp|Q5R1W9|LDHA_PANTR L-lactate dehydrogenase A chain OS=Pan troglodytes GN=LDHA PE=2 SV=3 19 328 7.0E-12
sp|A9A450|MDH_NITMS Malate dehydrogenase OS=Nitrosopumilus maritimus (strain SCM1) GN=mdh PE=3 SV=1 25 309 8.0E-12
sp|P00338|LDHA_HUMAN L-lactate dehydrogenase A chain OS=Homo sapiens GN=LDHA PE=1 SV=2 19 328 8.0E-12
sp|Q9YEA1|MDH_AERPE Malate dehydrogenase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=mdh PE=1 SV=2 21 238 8.0E-12
sp|A4IKL5|LDH_GEOTN L-lactate dehydrogenase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=ldh PE=3 SV=1 19 319 1.0E-11
sp|B0K226|LDH_THEPX L-lactate dehydrogenase OS=Thermoanaerobacter sp. (strain X514) GN=ldh PE=3 SV=1 18 300 1.0E-11
sp|B0KDA4|LDH_THEP3 L-lactate dehydrogenase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=ldh PE=3 SV=1 18 300 1.0E-11
sp|Q97VN4|MDH_SULSO Probable malate dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=mdh PE=3 SV=2 18 205 2.0E-11
sp|P62052|LDH1_LACJO L-lactate dehydrogenase 1 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=ldh1 PE=3 SV=1 14 324 2.0E-11
sp|A3MWU9|MDH_PYRCJ Malate dehydrogenase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=mdh PE=3 SV=1 54 207 2.0E-11
sp|A7Z152|LDH_BACMF L-lactate dehydrogenase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ldh PE=3 SV=1 18 256 2.0E-11
sp|Q839C1|LDH1_ENTFA L-lactate dehydrogenase 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=ldh1 PE=3 SV=1 12 323 2.0E-11
sp|Q704B2|MDH_THETK Malate dehydrogenase OS=Thermoproteus tenax (strain ATCC 35583 / NBRC 100435 / JCM 9277 / Kra 1) GN=mdh PE=3 SV=1 54 207 3.0E-11
sp|P84793|LDH_PLABE L-lactate dehydrogenase OS=Plasmodium berghei PE=3 SV=1 23 309 3.0E-11
sp|Q7SI97|LDH_PLABA L-lactate dehydrogenase OS=Plasmodium berghei (strain Anka) GN=PB000185.00.0 PE=1 SV=2 23 309 3.0E-11
sp|Q9TSX5|LDHC_PIG L-lactate dehydrogenase C chain OS=Sus scrofa GN=LDHC PE=2 SV=3 19 328 3.0E-11
sp|Q29563|LDHC_VULVU L-lactate dehydrogenase C chain OS=Vulpes vulpes GN=LDHC PE=2 SV=3 20 328 4.0E-11
sp|A8F6M1|LDH_PSELT L-lactate dehydrogenase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=ldh PE=3 SV=1 20 322 4.0E-11
sp|A9BGZ9|LDH_PETMO L-lactate dehydrogenase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ldh PE=3 SV=1 20 195 4.0E-11
sp|A7HM89|LDH_FERNB L-lactate dehydrogenase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=ldh PE=3 SV=1 20 324 4.0E-11
sp|P20619|LDHX_BACPS L-lactate dehydrogenase X OS=Bacillus psychrosaccharolyticus GN=ldhX PE=3 SV=1 16 255 5.0E-11
sp|Q6HK31|LDH1_BACHK L-lactate dehydrogenase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ldh1 PE=3 SV=1 16 206 5.0E-11
sp|Q63CN1|LDH1_BACCZ L-lactate dehydrogenase 1 OS=Bacillus cereus (strain ZK / E33L) GN=ldh1 PE=3 SV=1 16 206 5.0E-11
sp|P62047|LDH1_BACC1 L-lactate dehydrogenase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ldh1 PE=3 SV=1 16 206 5.0E-11
sp|Q81RW4|LDH1_BACAN L-lactate dehydrogenase 1 OS=Bacillus anthracis GN=ldh1 PE=3 SV=1 16 206 5.0E-11
sp|Q81EP4|LDH1_BACCR L-lactate dehydrogenase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ldh1 PE=1 SV=1 16 206 5.0E-11
sp|P11386|MDH_SULAC Malate dehydrogenase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=mdh PE=1 SV=3 18 205 6.0E-11
sp|P13715|LDH_THEAQ L-lactate dehydrogenase OS=Thermus aquaticus GN=ldh PE=1 SV=2 20 298 6.0E-11
sp|P99119|LDH2_STAAN L-lactate dehydrogenase 2 OS=Staphylococcus aureus (strain N315) GN=ldhB PE=1 SV=1 16 254 6.0E-11
sp|P65258|LDH2_STAAM L-lactate dehydrogenase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ldhB PE=3 SV=1 16 254 6.0E-11
sp|A5IW27|LDH2_STAA9 L-lactate dehydrogenase 2 OS=Staphylococcus aureus (strain JH9) GN=ldh2 PE=3 SV=1 16 254 6.0E-11
sp|A6U4Y2|LDH2_STAA2 L-lactate dehydrogenase 2 OS=Staphylococcus aureus (strain JH1) GN=ldh2 PE=3 SV=1 16 254 6.0E-11
sp|A7X6Y1|LDH2_STAA1 L-lactate dehydrogenase 2 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ldh2 PE=3 SV=1 16 254 6.0E-11
sp|Q8NUM9|LDH2_STAAW L-lactate dehydrogenase 2 OS=Staphylococcus aureus (strain MW2) GN=ldhB PE=3 SV=1 16 254 7.0E-11
sp|P0C7U6|LDH2_STAAT L-lactate dehydrogenase 2 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ldh2 PE=3 SV=1 16 254 7.0E-11
sp|Q6G674|LDH2_STAAS L-lactate dehydrogenase 2 OS=Staphylococcus aureus (strain MSSA476) GN=ldh2 PE=3 SV=1 16 254 7.0E-11
sp|Q6GDK1|LDH2_STAAR L-lactate dehydrogenase 2 OS=Staphylococcus aureus (strain MRSA252) GN=ldh2 PE=3 SV=1 16 254 7.0E-11
sp|A6QK89|LDH2_STAAE L-lactate dehydrogenase 2 OS=Staphylococcus aureus (strain Newman) GN=ldh2 PE=1 SV=1 16 254 7.0E-11
sp|Q5HCV0|LDH2_STAAC L-lactate dehydrogenase 2 OS=Staphylococcus aureus (strain COL) GN=ldh2 PE=1 SV=1 16 254 7.0E-11
sp|Q2YWF6|LDH2_STAAB L-lactate dehydrogenase 2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ldh2 PE=3 SV=1 16 254 7.0E-11
sp|Q2G1Y5|LDH2_STAA8 L-lactate dehydrogenase 2 OS=Staphylococcus aureus (strain NCTC 8325) GN=ldh2 PE=3 SV=1 16 254 7.0E-11
sp|Q2FDQ7|LDH2_STAA3 L-lactate dehydrogenase 2 OS=Staphylococcus aureus (strain USA300) GN=ldh2 PE=3 SV=1 16 254 7.0E-11
sp|C5D5V2|LDH_GEOSW L-lactate dehydrogenase OS=Geobacillus sp. (strain WCH70) GN=ldh PE=3 SV=1 18 327 8.0E-11
sp|Q5L2S0|LDH_GEOKA L-lactate dehydrogenase OS=Geobacillus kaustophilus (strain HTA426) GN=ldh PE=3 SV=1 19 319 8.0E-11
sp|O32765|LDH_LACHE L-lactate dehydrogenase OS=Lactobacillus helveticus GN=ldh PE=1 SV=1 86 324 1.0E-10
sp|Q9P7P7|LDH_SCHPO Probable L-lactate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC186.08c PE=3 SV=1 20 323 1.0E-10
sp|Q8ZVB2|MDH_PYRAE Malate dehydrogenase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=mdh PE=3 SV=1 21 207 1.0E-10
sp|P58407|MDH_SULTO Probable malate dehydrogenase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=mdh PE=3 SV=1 18 205 2.0E-10
sp|Q3IU43|MDH_NATPD Malate dehydrogenase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=mdh PE=3 SV=1 57 324 2.0E-10
sp|Q9PW07|LDHA_COLLI L-lactate dehydrogenase A chain OS=Columba livia GN=LDHA PE=2 SV=3 19 328 2.0E-10
sp|P13714|LDH_BACSU L-lactate dehydrogenase OS=Bacillus subtilis (strain 168) GN=ldh PE=1 SV=3 16 256 2.0E-10
sp|P50934|LDH_LACSK L-lactate dehydrogenase OS=Lactobacillus sakei GN=ldh PE=3 SV=1 83 255 2.0E-10
sp|Q38V71|LDH_LACSS L-lactate dehydrogenase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ldh PE=3 SV=1 83 255 2.0E-10
sp|B9LZ61|LDH_GEODF L-lactate dehydrogenase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=ldh PE=3 SV=1 85 195 2.0E-10
sp|P62049|LDH3_BACC1 L-lactate dehydrogenase 3 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ldh3 PE=3 SV=1 16 237 2.0E-10
sp|P07864|LDHC_HUMAN L-lactate dehydrogenase C chain OS=Homo sapiens GN=LDHC PE=1 SV=4 20 328 3.0E-10
sp|A1VG02|LDH_DESVV L-lactate dehydrogenase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=ldh PE=3 SV=1 18 298 3.0E-10
sp|P62051|LDH_DESVH L-lactate dehydrogenase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=ldh PE=3 SV=1 18 298 3.0E-10
sp|P10655|LDH_BACCA L-lactate dehydrogenase OS=Bacillus caldotenax GN=ldh PE=3 SV=1 19 319 4.0E-10
sp|P19858|LDHA_BOVIN L-lactate dehydrogenase A chain OS=Bos taurus GN=LDHA PE=2 SV=2 19 328 4.0E-10
sp|P00340|LDHA_CHICK L-lactate dehydrogenase A chain OS=Gallus gallus GN=LDHA PE=1 SV=3 12 328 4.0E-10
sp|Q9W7L3|LDHA_PYTRG L-lactate dehydrogenase A chain OS=Python regius GN=LDHA PE=2 SV=3 19 328 5.0E-10
sp|P79912|LDHA_SCEWO L-lactate dehydrogenase A chain OS=Sceloporus woodi GN=LDHA PE=2 SV=4 19 328 5.0E-10
sp|A8F9Q8|LDH_BACP2 L-lactate dehydrogenase OS=Bacillus pumilus (strain SAFR-032) GN=ldh PE=3 SV=1 18 256 5.0E-10
sp|P0C0J4|LDH_MYCHY L-lactate dehydrogenase OS=Mycoplasma hyopneumoniae GN=ldh PE=3 SV=1 20 314 6.0E-10
sp|P0C0J3|LDH_MYCHJ L-lactate dehydrogenase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=ldh PE=1 SV=1 20 314 6.0E-10
sp|Q4A8M8|LDH_MYCH7 L-lactate dehydrogenase OS=Mycoplasma hyopneumoniae (strain 7448) GN=ldh PE=3 SV=1 20 314 6.0E-10
sp|Q98SL2|LDHA_CAICA L-lactate dehydrogenase A chain OS=Caiman crocodilus apaporiensis GN=LDHA PE=2 SV=3 19 328 6.0E-10
sp|P0C0J2|LDH_MYCH2 L-lactate dehydrogenase OS=Mycoplasma hyopneumoniae (strain 232) GN=ldh PE=3 SV=1 20 314 6.0E-10
sp|P13491|LDHA_RABIT L-lactate dehydrogenase A chain OS=Oryctolagus cuniculus GN=LDHA PE=1 SV=3 19 328 7.0E-10
sp|Q59244|LDH_BACCL L-lactate dehydrogenase OS=Bacillus caldolyticus GN=ldh PE=3 SV=1 19 300 7.0E-10
sp|Q2JJQ1|LDH_SYNJB L-lactate dehydrogenase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ldh PE=3 SV=1 27 256 9.0E-10
sp|Q6ZMR3|LDH6A_HUMAN L-lactate dehydrogenase A-like 6A OS=Homo sapiens GN=LDHAL6A PE=2 SV=1 88 312 1.0E-09
sp|P00344|LDH_GEOSE L-lactate dehydrogenase OS=Geobacillus stearothermophilus GN=ldh PE=1 SV=1 19 300 1.0E-09
sp|C1CR83|LDH_STRZT L-lactate dehydrogenase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=ldh PE=3 SV=1 14 333 1.0E-09
sp|C1CKW1|LDH_STRZP L-lactate dehydrogenase OS=Streptococcus pneumoniae (strain P1031) GN=ldh PE=3 SV=1 14 333 1.0E-09
sp|C1CEH8|LDH_STRZJ L-lactate dehydrogenase OS=Streptococcus pneumoniae (strain JJA) GN=ldh PE=3 SV=1 14 333 1.0E-09
sp|P0A3N0|LDH_STRR6 L-lactate dehydrogenase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ldh PE=1 SV=2 14 333 1.0E-09
sp|P0A3M9|LDH_STRPN L-lactate dehydrogenase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ldh PE=3 SV=2 14 333 1.0E-09
sp|B8ZQ84|LDH_STRPJ L-lactate dehydrogenase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=ldh PE=3 SV=1 14 333 1.0E-09
sp|B1IC17|LDH_STRPI L-lactate dehydrogenase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=ldh PE=3 SV=1 14 333 1.0E-09
sp|B5E4V6|LDH_STRP4 L-lactate dehydrogenase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=ldh PE=3 SV=1 14 333 1.0E-09
sp|Q04K99|LDH_STRP2 L-lactate dehydrogenase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=ldh PE=3 SV=1 14 333 1.0E-09
sp|P62056|LDH_TREDE L-lactate dehydrogenase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=ldh PE=3 SV=1 20 195 1.0E-09
sp|P62053|LDH2_LACJO L-lactate dehydrogenase 2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=ldh2 PE=3 SV=1 28 300 1.0E-09
sp|C1C7I6|LDH_STRP7 L-lactate dehydrogenase OS=Streptococcus pneumoniae (strain 70585) GN=ldh PE=3 SV=1 14 333 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6466
MFASKIQRRAFSASARNLSKVAVLGAAGGIGQPLSLLLKMNPRVTDLALYDIRLAPGVAADISHINTKSTVKGYD
PTPSGLASCLKGSEVVLIPAGVPRKPGMTRDDLFNTNASIVRDLAKAVAESAPKAKLLIIANPVNSTVPICAEVF
KAKGVYNPKLLFGVTTLDVVRASRFVSEIKKTDPKDENITVVGGHSGLTIVPLFSQSRHPDLSSNEELIKRVQFG
GDEVVQAKDGAGSATLSMAMAGARMAESLLRAGQGEKGVVEPTFVDSPLYKDQGIDFFSSKVELGPNGVEKILPI
GKVDATEEKLLQACLGDLKKNIQKGVDFVAKNPGN*
Coding >Hirsu2|6466
ATGTTCGCCTCCAAGATCCAGCGTCGGGCCTTTTCCGCCTCTGCGCGCAACCTTTCCAAGGTCGCCGTTCTCGGC
GCCGCCGGCGGCATTGGCCAGCCTCTTTCCCTGCTGCTCAAGATGAACCCCAGAGTGACCGATCTGGCCCTCTAC
GATATCCGCCTCGCTCCCGGCGTCGCTGCCGACATCTCCCACATCAACACCAAGTCCACCGTCAAGGGCTATGAC
CCGACGCCCAGCGGCCTCGCCTCGTGCCTCAAGGGCTCCGAGGTCGTCCTGATCCCCGCCGGCGTGCCGCGCAAG
CCCGGTATGACGCGCGACGACCTCTTCAACACCAACGCCTCCATCGTCCGCGACCTGGCCAAGGCCGTCGCCGAG
TCCGCCCCCAAGGCCAAGCTGCTCATCATCGCCAACCCCGTCAACTCGACCGTCCCCATCTGCGCCGAGGTCTTC
AAGGCCAAGGGCGTCTACAACCCCAAGCTGCTGTTCGGCGTCACCACCCTCGACGTCGTCCGCGCCAGCCGCTTC
GTCTCCGAGATCAAGAAGACGGACCCCAAGGACGAGAACATCACCGTCGTCGGCGGCCACTCCGGCCTGACCATC
GTCCCCCTCTTCAGCCAGAGCCGGCACCCCGACCTGAGCTCCAACGAGGAGCTCATCAAGCGCGTCCAGTTCGGC
GGCGACGAGGTCGTCCAGGCCAAGGACGGCGCCGGCTCGGCCACCCTGTCCATGGCCATGGCCGGCGCCCGCATG
GCCGAGTCCCTGCTCCGCGCCGGCCAGGGCGAGAAGGGCGTCGTCGAGCCCACCTTTGTCGACTCCCCGCTCTAC
AAGGACCAGGGCATCGACTTCTTCAGCAGCAAGGTTGAGCTTGGCCCCAACGGCGTCGAGAAGATCCTGCCCATC
GGCAAGGTCGACGCCACCGAGGAAAAGCTCCTCCAGGCCTGCCTGGGCGACCTCAAGAAGAACATCCAAAAGGGC
GTCGACTTCGTCGCCAAGAACCCCGGCAACTAA
Transcript >Hirsu2|6466
ATGTTCGCCTCCAAGATCCAGCGTCGGGCCTTTTCCGCCTCTGCGCGCAACCTTTCCAAGGTCGCCGTTCTCGGC
GCCGCCGGCGGCATTGGCCAGCCTCTTTCCCTGCTGCTCAAGATGAACCCCAGAGTGACCGATCTGGCCCTCTAC
GATATCCGCCTCGCTCCCGGCGTCGCTGCCGACATCTCCCACATCAACACCAAGTCCACCGTCAAGGGCTATGAC
CCGACGCCCAGCGGCCTCGCCTCGTGCCTCAAGGGCTCCGAGGTCGTCCTGATCCCCGCCGGCGTGCCGCGCAAG
CCCGGTATGACGCGCGACGACCTCTTCAACACCAACGCCTCCATCGTCCGCGACCTGGCCAAGGCCGTCGCCGAG
TCCGCCCCCAAGGCCAAGCTGCTCATCATCGCCAACCCCGTCAACTCGACCGTCCCCATCTGCGCCGAGGTCTTC
AAGGCCAAGGGCGTCTACAACCCCAAGCTGCTGTTCGGCGTCACCACCCTCGACGTCGTCCGCGCCAGCCGCTTC
GTCTCCGAGATCAAGAAGACGGACCCCAAGGACGAGAACATCACCGTCGTCGGCGGCCACTCCGGCCTGACCATC
GTCCCCCTCTTCAGCCAGAGCCGGCACCCCGACCTGAGCTCCAACGAGGAGCTCATCAAGCGCGTCCAGTTCGGC
GGCGACGAGGTCGTCCAGGCCAAGGACGGCGCCGGCTCGGCCACCCTGTCCATGGCCATGGCCGGCGCCCGCATG
GCCGAGTCCCTGCTCCGCGCCGGCCAGGGCGAGAAGGGCGTCGTCGAGCCCACCTTTGTCGACTCCCCGCTCTAC
AAGGACCAGGGCATCGACTTCTTCAGCAGCAAGGTTGAGCTTGGCCCCAACGGCGTCGAGAAGATCCTGCCCATC
GGCAAGGTCGACGCCACCGAGGAAAAGCTCCTCCAGGCCTGCCTGGGCGACCTCAAGAAGAACATCCAAAAGGGC
GTCGACTTCGTCGCCAAGAACCCCGGCAACTAA
Gene >Hirsu2|6466
ATGTTCGCCTCCAAGATCCAGCGTCGGGCCTTTTCCGCCTCTGCGCGCAACGTGCGTCTGCCATTGGGCCTTCTC
CCCGGCCTCTCCCCGGCCCACCAGAGGCCTGCCGAGGGCTGGCCATAGCTCTCTCTCTGTGTGCTGCACTTTGCC
TTACTGACCCGTCCCTGGCCCGCCTCAGCTTTCCAAGGTCGCCGTTCTCGGCGCCGCCGGCGGCATTGGCCAGCC
TCTTTCCCTGCTGCTCAAGATGAACCCCAGAGTGACCGATCTGGCCCTCTACGATATCCGCCTCGCTCCCGGTGC
GCCGCTCCCTCTGATCCGTACCCCGATACAAACCCCCCCCAGCCGGGCCTTTTCTCCTTACCCCCGACTCTGACG
GCTTCGGCGTGAGACAGGCGTCGCTGCCGACATCTCCCACATCAACACCAAGTCCACCGTCAAGGGCTATGACCC
GACGCCCAGCGGCCTCGCCTCGTGCCTCAAGGGCTCCGAGGTCGTCCTGATCCCCGCCGGCGTGCCGCGCAAGCC
CGGTATGACGCGCGACGACCTCTTCAACACCAACGCCTCCATCGTCCGCGACCTGGCCAAGGCCGTCGCCGAGTC
CGCCCCCAAGGCCAAGCTGCTCATCATCGCCAACCCCGTCAACTCGACCGTCCCCATCTGCGCCGAGGTCTTCAA
GGCCAAGGGCGTCTACAACCCCAAGCTGCTGTTCGGCGTCACCACCCTCGACGTCGTCCGCGCCAGCCGCTTCGT
CTCCGAGATCAAGAAGACGGACCCCAAGGACGAGAACATCACCGTCGTCGGCGGCCACTCCGGCCTGACCATCGT
CCCCCTCTTCAGCCAGAGCCGGCACCCCGACCTGAGCTCCAACGAGGAGCTCATCAAGCGCGTCCAGTTCGGCGG
CGACGAGGTCGTCCAGGCCAAGGACGGCGCCGGCTCGGCCACCCTGTCCATGGCCATGGCCGGCGCCCGCATGGC
CGAGTCCCTGCTCCGCGCCGGCCAGGGCGAGAAGGGCGTCGTCGAGCCCACCTTTGTCGACTCCCCGCTCTACAA
GGACCAGGGCATCGACTTCTTCAGCAGCAAGGTTGAGCTTGGCCCCAACGGCGTCGAGAAGATCCTGCCCATCGG
CAAGGTCGACGCCACCGAGGAAAAGCTCCTCCAGGCCTGCCTGGGCGACCTCAAGAAGAACATCCAAAAGGGCGT
CGACTTCGTCGCCAAGAACCCCGGCAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail