Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|646
Gene name
LocationContig_113:8822..9979
Strand+
Gene length (bp)1157
Transcript length (bp)903
Coding sequence length (bp)903
Protein length (aa) 301

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01083 Cutinase Cutinase 1.7E-46 28 228
PF08237 PE-PPE PE-PPE domain 2.9E-05 73 119

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59893|AXE2_TALPU Acetylxylan esterase 2 OS=Talaromyces purpurogenus GN=axe-2 PE=1 SV=1 32 225 6.0E-23
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 32 225 2.0E-18
sp|P9WP39|CUT3_MYCTU Probable cutinase cut3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cut3 PE=1 SV=1 37 228 1.0E-11
sp|P0A537|CUT3_MYCBO Probable cutinase cut3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cut3 PE=3 SV=1 37 228 1.0E-11
sp|P9WP38|CUT3_MYCTO Probable cutinase cut3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cut3 PE=3 SV=1 37 228 1.0E-11

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|646
MRRSTVSVTALVAGLASAAAAQNGTASCATGLHLIVARGTSEPKGAGVTGLLADRIERQIAGSRVAPLDYPATLS
KPDYEDSVAAGVQAMRSAVEQYAQECPRSKVAIMGYSQGAQVSMDTLCGGTGAGFRSSTPLPAKLVKDNVVAIVL
FGDPTHVANITYDRGTSVKDGIFQRDNGTVRTCEAYADRMVSYCDTGDIYCDSGEDNKVHGLYVPRYGDEVVKYV
VGRYHDSVKGEGGGRNSSASSTATAAPTSSSATASATGARGSSGTASAAPGRFVADSSVYLALSSLALAALQALL
*
Coding >Hirsu2|646
ATGCGTCGGAGCACCGTGTCAGTGACGGCCTTGGTCGCCGGGCTTGCGTCGGCGGCGGCAGCGCAAAACGGCACG
GCGAGCTGCGCCACGGGGCTGCACCTGATCGTCGCGCGCGGCACGAGCGAGCCCAAGGGCGCCGGCGTCACGGGC
CTGCTGGCGGATCGGATCGAGAGGCAGATCGCGGGCTCGCGGGTGGCGCCGCTCGACTACCCGGCGACGCTGTCG
AAGCCCGACTACGAGGACTCGGTGGCCGCGGGCGTCCAGGCGATGCGGTCCGCCGTCGAGCAGTACGCCCAGGAG
TGCCCCAGGTCCAAGGTGGCCATCATGGGCTATTCGCAGGGCGCCCAAGTTTCGATGGACACGCTTTGCGGCGGT
ACCGGGGCCGGCTTCAGGAGCTCGACACCGCTCCCCGCCAAGCTGGTCAAAGACAACGTCGTGGCCATCGTCCTG
TTCGGCGACCCAACGCACGTCGCCAACATCACCTACGACAGGGGAACCAGTGTTAAGGACGGGATCTTCCAGCGC
GACAACGGCACCGTCCGAACCTGCGAAGCGTACGCCGACCGCATGGTGTCCTACTGCGACACGGGAGACATCTAC
TGCGATTCGGGCGAGGACAACAAGGTCCACGGCCTGTACGTTCCTCGGTACGGCGACGAGGTGGTCAAGTACGTC
GTCGGCCGGTACCACGACTCGGTCAAGGGGGAGGGCGGCGGCCGCAACAGCAGCGCAAGCAGCACGGCGACGGCG
GCGCCCACGTCCTCGTCGGCAACGGCGTCGGCAACGGGCGCGAGAGGCAGCTCCGGCACCGCCTCGGCGGCCCCG
GGCCGCTTCGTCGCGGACAGCAGCGTCTATCTGGCCCTGTCGTCCCTGGCGCTGGCCGCGCTGCAGGCGTTGCTG
TAG
Transcript >Hirsu2|646
ATGCGTCGGAGCACCGTGTCAGTGACGGCCTTGGTCGCCGGGCTTGCGTCGGCGGCGGCAGCGCAAAACGGCACG
GCGAGCTGCGCCACGGGGCTGCACCTGATCGTCGCGCGCGGCACGAGCGAGCCCAAGGGCGCCGGCGTCACGGGC
CTGCTGGCGGATCGGATCGAGAGGCAGATCGCGGGCTCGCGGGTGGCGCCGCTCGACTACCCGGCGACGCTGTCG
AAGCCCGACTACGAGGACTCGGTGGCCGCGGGCGTCCAGGCGATGCGGTCCGCCGTCGAGCAGTACGCCCAGGAG
TGCCCCAGGTCCAAGGTGGCCATCATGGGCTATTCGCAGGGCGCCCAAGTTTCGATGGACACGCTTTGCGGCGGT
ACCGGGGCCGGCTTCAGGAGCTCGACACCGCTCCCCGCCAAGCTGGTCAAAGACAACGTCGTGGCCATCGTCCTG
TTCGGCGACCCAACGCACGTCGCCAACATCACCTACGACAGGGGAACCAGTGTTAAGGACGGGATCTTCCAGCGC
GACAACGGCACCGTCCGAACCTGCGAAGCGTACGCCGACCGCATGGTGTCCTACTGCGACACGGGAGACATCTAC
TGCGATTCGGGCGAGGACAACAAGGTCCACGGCCTGTACGTTCCTCGGTACGGCGACGAGGTGGTCAAGTACGTC
GTCGGCCGGTACCACGACTCGGTCAAGGGGGAGGGCGGCGGCCGCAACAGCAGCGCAAGCAGCACGGCGACGGCG
GCGCCCACGTCCTCGTCGGCAACGGCGTCGGCAACGGGCGCGAGAGGCAGCTCCGGCACCGCCTCGGCGGCCCCG
GGCCGCTTCGTCGCGGACAGCAGCGTCTATCTGGCCCTGTCGTCCCTGGCGCTGGCCGCGCTGCAGGCGTTGCTG
TAG
Gene >Hirsu2|646
ATGCGTCGGAGCACCGTGTCAGTGACGGCCTTGGTCGCCGGGCTTGCGTCGGCGGCGGCAGCGCAAAACGGCACG
GCGAGCTGCGCCACGGGGCTGCACCTGATCGTCGCGCGCGGCACGAGCGAGCCCAAGGGCGCCGGCGTCACGGGC
CTGCTGGCGGATCGGATCGAGAGGCAGATCGCGGGCTCGCGGGTGGCGCCGCTCGACTACCCGGCGACGCTGTCG
AAGCCCGACTACGAGGACTCGGTGGCCGCGGGCGTCCAGGCGATGCGGTCCGCCGTCGAGCAGTACGCCCAGGAG
TGCCCCAGGTCCAAGGTGGCCATCATGGGCTATTCGCAGGTGAGCGCCGGCCCGACGAACGACCACCACCTCGCA
TTCGACTATCCCTACTTCTCCTTCGAGCTGTGCGGAGAGGTCGCTGACGGGCCTCAAATCGGGTCGCGAGCATAG
GGCGCCCAAGTTTCGATGGACACGCTTTGCGGCGGTACCGGGGCCGGCTTCAGGAGCTCGACACCGCTCCCCGCC
AAGCTGGTCAAAGACAACGGTGGGTACTGGCAGTGTCGCAGTGCTGCCTCAAACCAAGCTTTCAGGGCAGCCCAA
GGCTGACTCGGCCTTTTTGTGCTGCCTCCCAGTCGTGGCCATCGTCCTGTTCGGCGACCCAACGCACGTCGCCAA
CATCACCTACGACAGGGGAACCAGTGTTAAGGACGGGGTGAGTCCGGCCGGGCCGTTGCTCGGCAGACGAGTGGC
TGAGCGAGACGTGGCAGATCTTCCAGCGCGACAACGGCACCGTCCGAACCTGCGAAGCGTACGCCGACCGCATGG
TGTCCTACTGCGACACGGGAGACATCTACTGCGATTCGGGCGAGGACAACAAGGTCCACGGCCTGTACGTTCCTC
GGTACGGCGACGAGGTGGTCAAGTACGTCGTCGGCCGGTACCACGACTCGGTCAAGGGGGAGGGCGGCGGCCGCA
ACAGCAGCGCAAGCAGCACGGCGACGGCGGCGCCCACGTCCTCGTCGGCAACGGCGTCGGCAACGGGCGCGAGAG
GCAGCTCCGGCACCGCCTCGGCGGCCCCGGGCCGCTTCGTCGCGGACAGCAGCGTCTATCTGGCCCTGTCGTCCC
TGGCGCTGGCCGCGCTGCAGGCGTTGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail