Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6453
Gene name
LocationContig_331:14656..16468
Strand-
Gene length (bp)1812
Transcript length (bp)1707
Coding sequence length (bp)1707
Protein length (aa) 569

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 1.6E-06 485 526

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25357|SNT1_YEAST Probable DNA-binding protein SNT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNT1 PE=1 SV=2 469 547 2.0E-11
sp|Q8QG78|NCOR1_XENLA Nuclear receptor corepressor 1 OS=Xenopus laevis GN=ncor1 PE=1 SV=1 106 259 7.0E-10
sp|Q4KKX4|NCOR1_XENTR Nuclear receptor corepressor 1 OS=Xenopus tropicalis GN=ncor1 PE=2 SV=1 114 259 9.0E-09
sp|Q9Y618|NCOR2_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens GN=NCOR2 PE=1 SV=2 106 252 1.0E-08
sp|Q9WU42|NCOR2_MOUSE Nuclear receptor corepressor 2 OS=Mus musculus GN=Ncor2 PE=1 SV=3 106 252 5.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25357|SNT1_YEAST Probable DNA-binding protein SNT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNT1 PE=1 SV=2 469 547 2.0E-11
sp|Q8QG78|NCOR1_XENLA Nuclear receptor corepressor 1 OS=Xenopus laevis GN=ncor1 PE=1 SV=1 106 259 7.0E-10
sp|Q4KKX4|NCOR1_XENTR Nuclear receptor corepressor 1 OS=Xenopus tropicalis GN=ncor1 PE=2 SV=1 114 259 9.0E-09
sp|Q9Y618|NCOR2_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens GN=NCOR2 PE=1 SV=2 106 252 1.0E-08
sp|Q9WU42|NCOR2_MOUSE Nuclear receptor corepressor 2 OS=Mus musculus GN=Ncor2 PE=1 SV=3 106 252 5.0E-08
sp|Q60974|NCOR1_MOUSE Nuclear receptor corepressor 1 OS=Mus musculus GN=Ncor1 PE=1 SV=1 105 258 8.0E-08
sp|O75376|NCOR1_HUMAN Nuclear receptor corepressor 1 OS=Homo sapiens GN=NCOR1 PE=1 SV=2 105 258 8.0E-08
sp|Q10369|YDBJ_SCHPO Uncharacterized protein C22E12.19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.19 PE=3 SV=2 152 267 5.0E-07
sp|Q55DP9|MYBP_DICDI Myb-like protein P OS=Dictyostelium discoideum GN=mybP PE=3 SV=1 135 250 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6453
MTTPPVDSLPDYSMPDWTKDKDFLASLDSDPAIDDFVTEHLNKIHLQEVEERTRGQKAYAENYVHYLEFTMSDDP
AAVKSREKFSVSAPSLDGVGTVTPETKPEGRGTGRRFATERDLERVLQASMREDEERKERELRAQKEKCRSDKEV
VIPDMLCSEEQRTMSQYLDRSGFTPPDRLVSAWHVLPPVNNFTQEESELFEKRYLELPKQWGKVAEIIPKRDFGT
CIQYYYLMKKELNLKEKLKKQPKRRKKGGRGKQRSSALVSELGNGEQEGEENQEAGENGERRRPRRAAAPTWGFE
QPATDSENATPAGTPGRRGASTAAKGDQPEKVDGRKGRRKAAKDKEAKGTKANQVLAAAPTATAGRGRSRSSSRA
PNSELLTPAPSDANVRMPVPFEQQPVAAPPGIHPPFPVQQQQQQQQQQPPPQPAPNAERPKAPAASSISEVMAAP
SLRPEPPPPLPQPSMATLNLAQPQAERKAATQPTSYWSVSEANDFPHLLRAFGSDWTSIAAHMGSKTAVMVKNYF
ARQKDQGKAEWEGIVQEADAKRVRGEKRPDPPQPTAGGRGHSR*
Coding >Hirsu2|6453
ATGACAACACCTCCTGTCGACAGCCTTCCAGACTATAGCATGCCAGACTGGACCAAGGACAAAGACTTCCTTGCA
TCGTTAGACTCGGATCCTGCAATCGACGACTTTGTGACGGAGCATCTGAACAAAATCCATTTGCAGGAAGTTGAG
GAGCGAACCCGCGGTCAAAAGGCATACGCCGAGAACTATGTCCATTATCTCGAGTTCACTATGTCGGATGATCCT
GCGGCCGTGAAGAGCAGGGAAAAATTCTCCGTCTCTGCACCGTCTCTGGACGGGGTCGGCACCGTCACTCCAGAA
ACCAAGCCAGAAGGGCGTGGCACGGGAAGGAGGTTTGCCACCGAACGCGATCTGGAGCGTGTCCTTCAGGCATCG
ATGCGCGAAGATGAAGAGAGGAAGGAGCGCGAACTCAGAGCTCAGAAGGAAAAATGTCGCAGCGATAAGGAGGTT
GTGATACCCGACATGCTCTGCAGCGAAGAGCAGCGGACCATGTCGCAGTACTTGGATCGATCCGGGTTCACCCCA
CCAGACAGACTCGTCTCGGCATGGCACGTGCTGCCACCCGTCAACAACTTCACACAGGAAGAGTCTGAGCTCTTC
GAGAAGCGATATCTGGAACTTCCTAAGCAGTGGGGCAAGGTTGCCGAGATCATACCGAAACGCGACTTCGGCACC
TGCATTCAGTACTACTACTTGATGAAGAAGGAACTCAACCTCAAGGAGAAACTCAAGAAGCAACCTAAGCGTCGC
AAGAAGGGTGGAAGAGGCAAGCAAAGATCTAGCGCTCTGGTGTCGGAGCTCGGCAACGGGGAGCAAGAAGGCGAG
GAGAATCAGGAGGCGGGAGAGAACGGTGAGAGGAGGCGGCCACGCCGTGCGGCCGCTCCTACATGGGGCTTTGAA
CAACCGGCCACGGACAGCGAGAACGCCACGCCTGCAGGCACCCCGGGCCGCCGAGGAGCCTCTACTGCTGCGAAG
GGCGATCAGCCAGAGAAGGTGGACGGCAGGAAGGGGAGGCGCAAGGCTGCGAAAGACAAGGAAGCCAAGGGAACG
AAGGCGAATCAGGTTCTTGCCGCCGCGCCAACTGCGACCGCTGGGCGAGGGCGCTCGCGCTCTAGCTCACGAGCA
CCCAACTCCGAACTTCTGACGCCGGCGCCTTCCGATGCCAACGTCCGTATGCCGGTTCCTTTCGAGCAGCAGCCG
GTGGCGGCGCCGCCTGGAATACATCCTCCTTTTCCCGTGCAGCAGCAGCAGCAGCAACAACAGCAACAGCCGCCA
CCGCAGCCTGCGCCCAATGCTGAGCGCCCGAAGGCCCCGGCCGCCTCGTCTATCTCGGAAGTCATGGCGGCCCCT
TCGTTGAGGCCTGAGCCGCCACCGCCGCTGCCGCAGCCCTCCATGGCTACGTTGAATCTGGCACAGCCTCAGGCG
GAACGGAAAGCGGCCACACAACCCACAAGCTACTGGAGCGTGTCCGAAGCGAACGACTTCCCGCACCTGTTGCGA
GCTTTCGGATCGGATTGGACGTCCATCGCCGCCCACATGGGCTCCAAAACTGCTGTCATGGTCAAGAACTATTTT
GCTCGCCAAAAGGATCAGGGCAAAGCAGAATGGGAAGGCATTGTGCAGGAAGCGGATGCGAAGCGAGTTCGCGGC
GAGAAACGACCCGACCCGCCGCAACCCACGGCCGGCGGCCGGGGCCACTCGCGGTAG
Transcript >Hirsu2|6453
ATGACAACACCTCCTGTCGACAGCCTTCCAGACTATAGCATGCCAGACTGGACCAAGGACAAAGACTTCCTTGCA
TCGTTAGACTCGGATCCTGCAATCGACGACTTTGTGACGGAGCATCTGAACAAAATCCATTTGCAGGAAGTTGAG
GAGCGAACCCGCGGTCAAAAGGCATACGCCGAGAACTATGTCCATTATCTCGAGTTCACTATGTCGGATGATCCT
GCGGCCGTGAAGAGCAGGGAAAAATTCTCCGTCTCTGCACCGTCTCTGGACGGGGTCGGCACCGTCACTCCAGAA
ACCAAGCCAGAAGGGCGTGGCACGGGAAGGAGGTTTGCCACCGAACGCGATCTGGAGCGTGTCCTTCAGGCATCG
ATGCGCGAAGATGAAGAGAGGAAGGAGCGCGAACTCAGAGCTCAGAAGGAAAAATGTCGCAGCGATAAGGAGGTT
GTGATACCCGACATGCTCTGCAGCGAAGAGCAGCGGACCATGTCGCAGTACTTGGATCGATCCGGGTTCACCCCA
CCAGACAGACTCGTCTCGGCATGGCACGTGCTGCCACCCGTCAACAACTTCACACAGGAAGAGTCTGAGCTCTTC
GAGAAGCGATATCTGGAACTTCCTAAGCAGTGGGGCAAGGTTGCCGAGATCATACCGAAACGCGACTTCGGCACC
TGCATTCAGTACTACTACTTGATGAAGAAGGAACTCAACCTCAAGGAGAAACTCAAGAAGCAACCTAAGCGTCGC
AAGAAGGGTGGAAGAGGCAAGCAAAGATCTAGCGCTCTGGTGTCGGAGCTCGGCAACGGGGAGCAAGAAGGCGAG
GAGAATCAGGAGGCGGGAGAGAACGGTGAGAGGAGGCGGCCACGCCGTGCGGCCGCTCCTACATGGGGCTTTGAA
CAACCGGCCACGGACAGCGAGAACGCCACGCCTGCAGGCACCCCGGGCCGCCGAGGAGCCTCTACTGCTGCGAAG
GGCGATCAGCCAGAGAAGGTGGACGGCAGGAAGGGGAGGCGCAAGGCTGCGAAAGACAAGGAAGCCAAGGGAACG
AAGGCGAATCAGGTTCTTGCCGCCGCGCCAACTGCGACCGCTGGGCGAGGGCGCTCGCGCTCTAGCTCACGAGCA
CCCAACTCCGAACTTCTGACGCCGGCGCCTTCCGATGCCAACGTCCGTATGCCGGTTCCTTTCGAGCAGCAGCCG
GTGGCGGCGCCGCCTGGAATACATCCTCCTTTTCCCGTGCAGCAGCAGCAGCAGCAACAACAGCAACAGCCGCCA
CCGCAGCCTGCGCCCAATGCTGAGCGCCCGAAGGCCCCGGCCGCCTCGTCTATCTCGGAAGTCATGGCGGCCCCT
TCGTTGAGGCCTGAGCCGCCACCGCCGCTGCCGCAGCCCTCCATGGCTACGTTGAATCTGGCACAGCCTCAGGCG
GAACGGAAAGCGGCCACACAACCCACAAGCTACTGGAGCGTGTCCGAAGCGAACGACTTCCCGCACCTGTTGCGA
GCTTTCGGATCGGATTGGACGTCCATCGCCGCCCACATGGGCTCCAAAACTGCTGTCATGGTCAAGAACTATTTT
GCTCGCCAAAAGGATCAGGGCAAAGCAGAATGGGAAGGCATTGTGCAGGAAGCGGATGCGAAGCGAGTTCGCGGC
GAGAAACGACCCGACCCGCCGCAACCCACGGCCGGCGGCCGGGGCCACTCGCGGTAG
Gene >Hirsu2|6453
ATGACAACACCTCCTGTCGACAGCCTTCCAGACTATAGCATGCCAGACTGGACCAAGGACAAAGACTTCCTTGCA
TCGTTAGACTCGGATCCTGCAATCGACGACTTTGTGACGGAGCATCTGAACAAAATCCATTTGCAGGAAGTTGAG
GAGCGAACCCGCGGTCAAAAGGCATACGCCGAGAACTATGTCCATTATCTCGAGTTCACTATGTCGGATGATCCT
GCGGCCGTGAAGAGCAGGGAAAAATTCTCCGTCTCTGCACCGTCTCTGGACGGGGTCGGCACCGTCACTCCAGAA
ACCAAGCCAGAAGGGCGTGGCACGGGAAGGAGGTTTGCCACCGAACGCGATCTGGAGCGTGTCCTTCAGGCATCG
ATGCGCGAAGATGAAGAGAGGAAGGAGCGCGAACTCAGAGCTCAGAAGGAAAAATGTCGCAGCGATAAGGAGGTT
GTGATACCCGACATGCTCTGCAGCGAAGAGCAGCGGACCATGTCGCAGTACTTGGATCGATCCGGGTTCACCCCA
CCAGACAGACTCGTCTCGGCATGGCACGTGCTGCCACCCGTCAACAACTTCACACAGGAAGAGTCTGAGCTCTTC
GAGAAGCGATATCTGGAACTTCCTAAGCAGTGGGGCAAGGTTGCCGAGATCATACCGAAACGCGACTTCGGCACC
TGCATTCAGTACTACTACTTGATGAAGAAGGAACTCAACCTCAAGGAGAAACTCAAGAAGCAACCTAAGCGTCGC
AAGAAGGGTGGAAGAGGCAAGCAAAGATCTAGCGCTCTGGTGTCGGAGCTCGGCAACGGGGAGCAAGAAGGCGAG
GAGAATCAGGAGGCGGGAGAGAACGGTGAGAGGAGGCGGCCACGCCGTGCGGCCGCTCCTACATGGGGCTTTGAA
CAACCGGCCACGGACAGCGAGAACGCCACGCCTGCAGGCACCCCGGGCCGCCGAGGAGCCTCTACTGCTGCGAAG
GGCGATCAGCCAGAGAAGGTGGACGGCAGGAAGGGGAGGCGCAAGGCTGCGAAAGACAAGGAAGCCAAGGGAACG
AAGGCGAATCAGGTTCTTGCCGCCGCGCCAACTGCGACCGCTGGGCGAGGGCGCTCGCGCTCTAGCTCACGAGCA
CCCAACTCCGAACTTCTGACGCCGGCGCCTTCCGATGCCAACGTCCGTATGCCGGTTCCTTTCGAGCAGCAGCCG
GTGGCGGCGCCGCCTGGAATACATCCTCCTTTTCCCGTGCAGCAGCAGCAGCAGCAACAACAGCAACAGCCGCCA
CCGCAGCCTGCGCCCAATGCTGAGCGCCCGAAGGCCCCGGCCGCCTCGTCTATCTCGGAAGTCATGGCGGCCCCT
TCGTTGAGGCCTGAGCCGCCACCGCCGCTGCCGCAGCCCTCCATGGCTACGTTGAATCTGGCACAGCCTCAGGCG
GAACGGAAAGCGGCCACACAACCCACAAGCTACTGGAGCGTGTCCGAAGCGAACGACTTCCCGCACCTGTTGCGA
GCTTTCGGATCGGATTGGACGTCCATCGCCGCCCACATGGGCTCCAAAACTGCTGTCATGGTAAGCCCACCACCG
ACTTCGCGTTGCGTGCGTAATGGTCGATGTGCTGACTGGTCTTCGTTTGTTAGGTCAAGAACTATTTTGCTCGCC
AAAAGGATCAGGGCAAAGCAGAATGGGAAGGCATTGTGCAGGAAGCGGATGCGAAGCGAGTTCGCGGCGAGAAAC
GACCCGACCCGCCGCAACCCACGGCCGGCGGCCGGGGTAGGCGATACGAGAACGCGACGGTCAGCGCGTCCAGGC
CACTCGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail