Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6450
Gene name
LocationContig_331:9143..10111
Strand+
Gene length (bp)968
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 4.3E-46 58 227
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 4.5E-19 58 173
PF00025 Arf ADP-ribosylation factor family 2.6E-05 54 143

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96WY0|RHOC_EMENI GTP-binding protein rhoC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhoC PE=3 SV=2 21 239 4.0E-117
sp|Q874R1|RHO4_SCHPO GTP-binding protein rho4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho4 PE=1 SV=2 56 231 1.0E-83
sp|O42825|RHO1_CANAL GTP-binding protein RHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RHO1 PE=3 SV=1 57 226 6.0E-70
sp|P06780|RHO1_YEAST GTP-binding protein RHO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO1 PE=1 SV=3 57 226 2.0E-68
sp|Q09914|RHO1_SCHPO GTP-binding protein rho1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho1 PE=2 SV=1 52 226 3.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96WY0|RHOC_EMENI GTP-binding protein rhoC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhoC PE=3 SV=2 21 239 4.0E-117
sp|Q874R1|RHO4_SCHPO GTP-binding protein rho4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho4 PE=1 SV=2 56 231 1.0E-83
sp|O42825|RHO1_CANAL GTP-binding protein RHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RHO1 PE=3 SV=1 57 226 6.0E-70
sp|P06780|RHO1_YEAST GTP-binding protein RHO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO1 PE=1 SV=3 57 226 2.0E-68
sp|Q09914|RHO1_SCHPO GTP-binding protein rho1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho1 PE=2 SV=1 52 226 3.0E-68
sp|Q8J212|RHO1_KLULA GTP-binding protein Rho1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RHO1 PE=3 SV=1 36 226 5.0E-68
sp|Q9HF54|RHO1_ASHGO GTP-binding protein RHO1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO1 PE=3 SV=1 46 226 4.0E-67
sp|Q9C3Y4|RHOA_EMENI GTP-binding protein rhoA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhoA PE=3 SV=1 57 226 5.0E-67
sp|Q22038|RHO1_CAEEL Ras-like GTP-binding protein rhoA OS=Caenorhabditis elegans GN=rho-1 PE=1 SV=1 57 226 5.0E-67
sp|P48148|RHO1_DROME Ras-like GTP-binding protein Rho1 OS=Drosophila melanogaster GN=Rho1 PE=1 SV=1 54 271 1.0E-66
sp|Q5REY6|RHOA_PONAB Transforming protein RhoA OS=Pongo abelii GN=RHOA PE=2 SV=2 57 241 3.0E-66
sp|P61586|RHOA_HUMAN Transforming protein RhoA OS=Homo sapiens GN=RHOA PE=1 SV=1 57 241 3.0E-66
sp|P61585|RHOA_BOVIN Transforming protein RhoA OS=Bos taurus GN=RHOA PE=1 SV=1 57 241 3.0E-66
sp|P61589|RHOA_RAT Transforming protein RhoA OS=Rattus norvegicus GN=Rhoa PE=1 SV=1 57 241 4.0E-66
sp|Q9QUI0|RHOA_MOUSE Transforming protein RhoA OS=Mus musculus GN=Rhoa PE=1 SV=1 57 241 4.0E-66
sp|P01122|RHO_APLCA Ras-like GTP-binding protein RHO OS=Aplysia californica GN=RHO PE=2 SV=1 57 226 4.0E-66
sp|Q5RCK9|RHOC_PONAB Rho-related GTP-binding protein RhoC OS=Pongo abelii GN=RHOC PE=2 SV=1 57 236 7.0E-66
sp|Q62159|RHOC_MOUSE Rho-related GTP-binding protein RhoC OS=Mus musculus GN=Rhoc PE=1 SV=2 57 236 7.0E-66
sp|P08134|RHOC_HUMAN Rho-related GTP-binding protein RhoC OS=Homo sapiens GN=RHOC PE=1 SV=1 57 236 7.0E-66
sp|Q1RMJ6|RHOC_BOVIN Rho-related GTP-binding protein RhoC OS=Bos taurus GN=RHOC PE=2 SV=1 57 236 7.0E-66
sp|Q9HE04|RHO5_SCHPO GTP-binding protein rho5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho5 PE=3 SV=1 57 226 8.0E-66
sp|Q6DHM9|RHOAB_DANRE Rho-related GTP-binding protein RhoA-B OS=Danio rerio GN=rhoab PE=1 SV=1 57 226 3.0E-65
sp|P24406|RHOA_CANLF Transforming protein RhoA OS=Canis lupus familiaris GN=RHOA PE=2 SV=1 57 241 3.0E-65
sp|Q9PSX7|RHOC_CHICK Rho-related GTP-binding protein RhoC OS=Gallus gallus GN=RHOC PE=1 SV=1 57 244 4.0E-65
sp|Q7T2E8|RHOAC_DANRE Rho-related GTP-binding protein RhoA-C OS=Danio rerio GN=rhoac PE=1 SV=1 57 241 1.0E-64
sp|Q6NUX8|RHOAA_DANRE Rho-related GTP-binding protein RhoA-A OS=Danio rerio GN=rhoaa PE=1 SV=1 57 239 2.0E-64
sp|Q6DHE8|RHOAD_DANRE Rho-related GTP-binding protein RhoA-D OS=Danio rerio GN=rhoad PE=1 SV=1 57 241 4.0E-64
sp|P62747|RHOB_RAT Rho-related GTP-binding protein RhoB OS=Rattus norvegicus GN=Rhob PE=1 SV=1 57 226 5.0E-64
sp|P62746|RHOB_MOUSE Rho-related GTP-binding protein RhoB OS=Mus musculus GN=Rhob PE=1 SV=1 57 226 5.0E-64
sp|P62745|RHOB_HUMAN Rho-related GTP-binding protein RhoB OS=Homo sapiens GN=RHOB PE=1 SV=1 57 226 5.0E-64
sp|Q3ZBW5|RHOB_BOVIN Rho-related GTP-binding protein RhoB OS=Bos taurus GN=RHOB PE=2 SV=1 57 226 5.0E-64
sp|Q6RUV5|RAC1_RAT Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus GN=Rac1 PE=1 SV=1 58 231 9.0E-62
sp|P63001|RAC1_MOUSE Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus GN=Rac1 PE=1 SV=1 58 231 9.0E-62
sp|P63000|RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens GN=RAC1 PE=1 SV=1 58 231 9.0E-62
sp|P62999|RAC1_CANLF Ras-related C3 botulinum toxin substrate 1 OS=Canis lupus familiaris GN=RAC1 PE=2 SV=1 58 231 9.0E-62
sp|P62998|RAC1_BOVIN Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus GN=RAC1 PE=1 SV=1 58 231 9.0E-62
sp|Q03206|RAC1_CAEEL Ras-related protein ced-10 OS=Caenorhabditis elegans GN=ced-10 PE=1 SV=2 58 240 2.0E-60
sp|P34149|RACC_DICDI Rho-related protein racC OS=Dictyostelium discoideum GN=racC PE=1 SV=1 58 227 5.0E-60
sp|P60764|RAC3_MOUSE Ras-related C3 botulinum toxin substrate 3 OS=Mus musculus GN=Rac3 PE=1 SV=1 58 231 5.0E-60
sp|P60763|RAC3_HUMAN Ras-related C3 botulinum toxin substrate 3 OS=Homo sapiens GN=RAC3 PE=1 SV=1 58 231 5.0E-60
sp|P40792|RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster GN=Rac1 PE=1 SV=2 58 227 2.0E-59
sp|P15153|RAC2_HUMAN Ras-related C3 botulinum toxin substrate 2 OS=Homo sapiens GN=RAC2 PE=1 SV=1 58 239 3.0E-58
sp|P84096|RHOG_MOUSE Rho-related GTP-binding protein RhoG OS=Mus musculus GN=Rhog PE=1 SV=1 56 231 3.0E-58
sp|P84095|RHOG_HUMAN Rho-related GTP-binding protein RhoG OS=Homo sapiens GN=RHOG PE=1 SV=1 56 231 3.0E-58
sp|P84097|RHOG_CRICR Rho-related GTP-binding protein RhoG OS=Cricetus cricetus GN=RHOG PE=2 SV=1 56 231 3.0E-58
sp|P48554|RAC2_DROME Ras-related protein Rac2 OS=Drosophila melanogaster GN=Rac2 PE=1 SV=1 58 227 4.0E-58
sp|Q05144|RAC2_MOUSE Ras-related C3 botulinum toxin substrate 2 OS=Mus musculus GN=Rac2 PE=1 SV=1 58 239 4.0E-58
sp|P22122|RHO_DIPOM Ras-like GTP-binding protein O-RHO OS=Diplobatis ommata PE=2 SV=1 57 226 4.0E-58
sp|Q9TU25|RAC2_BOVIN Ras-related C3 botulinum toxin substrate 2 OS=Bos taurus GN=RAC2 PE=2 SV=1 58 231 4.0E-58
sp|P34148|RACB_DICDI Rho-related protein racB OS=Dictyostelium discoideum GN=racB PE=1 SV=1 56 235 1.0E-57
sp|Q9P8V0|RHO4_ASHGO GTP-binding protein RHO4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO4 PE=3 SV=1 31 271 4.0E-57
sp|P97348|RHOD_MOUSE Rho-related GTP-binding protein RhoD OS=Mus musculus GN=Rhod PE=1 SV=1 51 237 4.0E-57
sp|O88931|RAC2_CAVPO Ras-related C3 botulinum toxin substrate 2 OS=Cavia porcellus GN=RAC2 PE=2 SV=2 58 231 5.0E-57
sp|Q00246|RHO4_YEAST GTP-binding protein RHO4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO4 PE=1 SV=2 53 233 7.0E-57
sp|O00212|RHOD_HUMAN Rho-related GTP-binding protein RhoD OS=Homo sapiens GN=RHOD PE=1 SV=2 51 237 9.0E-57
sp|Q24814|RACA_ENTHI Rho-related protein racA OS=Entamoeba histolytica GN=RACA PE=3 SV=1 58 238 1.0E-56
sp|P33153|CRL1_CANAW GTP-binding RHO-like protein OS=Candida albicans (strain WO-1) GN=CRL1 PE=3 SV=2 54 227 2.0E-56
sp|P34144|RAC1A_DICDI Rho-related protein rac1A OS=Dictyostelium discoideum GN=rac1A PE=1 SV=2 58 242 2.0E-56
sp|Q9HBH0|RHOF_HUMAN Rho-related GTP-binding protein RhoF OS=Homo sapiens GN=RHOF PE=1 SV=1 58 238 1.0E-55
sp|Q10133|RHO2_SCHPO GTP-binding protein rho2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho2 PE=1 SV=1 57 226 1.0E-55
sp|Q8BYP3|RHOF_MOUSE Rho-related GTP-binding protein RhoF OS=Mus musculus GN=Rhof PE=1 SV=1 58 238 2.0E-55
sp|Q3SZA1|RHOF_BOVIN Rho-related GTP-binding protein RhoF OS=Bos taurus GN=RHOF PE=2 SV=1 58 238 3.0E-55
sp|P34146|RAC1C_DICDI Rho-related protein rac1C OS=Dictyostelium discoideum GN=rac1C PE=1 SV=2 58 231 3.0E-55
sp|P34145|RAC1B_DICDI Rho-related protein rac1B OS=Dictyostelium discoideum GN=rac1B PE=1 SV=2 58 249 4.0E-55
sp|Q24816|RACC_ENTHI Rho-related protein racC OS=Entamoeba histolytica GN=RACC PE=1 SV=1 49 233 1.0E-54
sp|Q16YG0|CDC42_AEDAE Cdc42 homolog OS=Aedes aegypti GN=Cdc42 PE=3 SV=1 58 228 2.0E-53
sp|C4YDI6|CDC42_CANAW Cell division control protein 42 homolog OS=Candida albicans (strain WO-1) GN=CDC42 PE=3 SV=1 58 228 2.0E-53
sp|P0CY33|CDC42_CANAL Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC42 PE=3 SV=1 58 228 2.0E-53
sp|P19073|CDC42_YEAST Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC42 PE=1 SV=2 58 228 3.0E-53
sp|Q17031|CDC42_ANOGA Cdc42 homolog OS=Anopheles gambiae GN=Cdc42 PE=2 SV=2 58 228 3.0E-53
sp|P40793|CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster GN=Cdc42 PE=1 SV=1 58 228 3.0E-53
sp|Q29HY3|CDC42_DROPS Cdc42 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Cdc42 PE=3 SV=1 58 228 4.0E-53
sp|Q9HF56|CDC42_ASHGO Cell division control protein 42 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CDC42 PE=3 SV=1 58 228 8.0E-53
sp|Q8CFN2|CDC42_RAT Cell division control protein 42 homolog OS=Rattus norvegicus GN=Cdc42 PE=1 SV=2 58 228 4.0E-52
sp|Q007T2|CDC42_PIG Cell division control protein 42 homolog OS=Sus scrofa GN=CDC42 PE=2 SV=2 58 228 4.0E-52
sp|P60766|CDC42_MOUSE Cell division control protein 42 homolog OS=Mus musculus GN=Cdc42 PE=1 SV=2 58 228 4.0E-52
sp|P60953|CDC42_HUMAN Cell division control protein 42 homolog OS=Homo sapiens GN=CDC42 PE=1 SV=2 58 228 4.0E-52
sp|P60952|CDC42_CANLF Cell division control protein 42 homolog OS=Canis lupus familiaris GN=CDC42 PE=2 SV=2 58 228 4.0E-52
sp|Q2KJ93|CDC42_BOVIN Cell division control protein 42 homolog OS=Bos taurus GN=CDC42 PE=1 SV=1 58 228 4.0E-52
sp|Q90694|CDC42_CHICK Cell division control protein 42 homolog OS=Gallus gallus GN=CDC42 PE=2 SV=1 58 228 5.0E-52
sp|Q4R4R6|CDC42_MACFA Cell division control protein 42 homolog OS=Macaca fascicularis GN=CDC42 PE=2 SV=1 58 228 6.0E-52
sp|Q94124|RAC2_CAEEL Ras-related protein rac-2 OS=Caenorhabditis elegans GN=rac-2 PE=3 SV=1 58 227 1.0E-51
sp|Q9GPS3|RACF2_DICDI Rho-related protein racF2 OS=Dictyostelium discoideum GN=racF2 PE=3 SV=1 58 231 6.0E-51
sp|O13928|RHO3_SCHPO GTP-binding protein rho3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho3 PE=1 SV=2 53 249 7.0E-51
sp|Q01112|CDC42_SCHPO Cell division control protein 42 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc42 PE=1 SV=1 58 228 1.0E-50
sp|Q05062|CDC42_CAEEL Cell division control protein 42 homolog OS=Caenorhabditis elegans GN=cdc-42 PE=1 SV=2 58 228 1.0E-50
sp|O96390|RACF1_DICDI Rho-related protein racF1 OS=Dictyostelium discoideum GN=racF1 PE=1 SV=1 58 231 2.0E-50
sp|Q9P8J9|RHO3_SCHCO GTP-binding protein Rho3 OS=Schizophyllum commune GN=RHO3 PE=2 SV=1 57 241 2.0E-50
sp|O76321|RECG_ENTHI Rho-related protein racG OS=Entamoeba histolytica GN=RACG PE=3 SV=1 58 232 4.0E-50
sp|Q23862|RACE_DICDI Rho-related protein racE OS=Dictyostelium discoideum GN=racE PE=1 SV=1 58 249 4.0E-50
sp|Q24817|RACD_ENTHI Rho-related protein racD (Fragment) OS=Entamoeba histolytica GN=RACD PE=2 SV=1 52 235 1.0E-49
sp|Q6SA80|RND3_RAT Rho-related GTP-binding protein RhoE OS=Rattus norvegicus GN=Rnd3 PE=2 SV=1 58 257 1.0E-48
sp|P61588|RND3_MOUSE Rho-related GTP-binding protein RhoE OS=Mus musculus GN=Rnd3 PE=1 SV=1 58 257 1.0E-48
sp|P61587|RND3_HUMAN Rho-related GTP-binding protein RhoE OS=Homo sapiens GN=RND3 PE=1 SV=1 58 257 1.0E-48
sp|Q5R9F4|RND3_PONAB Rho-related GTP-binding protein RhoE OS=Pongo abelii GN=RND3 PE=2 SV=1 58 257 1.0E-48
sp|O77683|RND3_PIG Rho-related GTP-binding protein RhoE OS=Sus scrofa GN=RND3 PE=2 SV=1 58 257 3.0E-48
sp|Q24815|RACB_ENTHI Rho-related protein racB (Fragment) OS=Entamoeba histolytica GN=RACB PE=3 SV=1 63 226 2.0E-47
sp|Q6Z808|RAC3_ORYSJ Rac-like GTP-binding protein 3 OS=Oryza sativa subsp. japonica GN=RAC3 PE=2 SV=1 58 239 5.0E-47
sp|Q9JJL4|RHOQ_RAT Rho-related GTP-binding protein RhoQ OS=Rattus norvegicus GN=Rhoq PE=2 SV=1 58 231 6.0E-47
sp|Q8R527|RHOQ_MOUSE Rho-related GTP-binding protein RhoQ OS=Mus musculus GN=Rhoq PE=1 SV=2 58 231 6.0E-47
sp|Q6Z7L8|RAC7_ORYSJ Rac-like GTP-binding protein 7 OS=Oryza sativa subsp. japonica GN=RAC7 PE=2 SV=1 58 231 7.0E-47
sp|P17081|RHOQ_HUMAN Rho-related GTP-binding protein RhoQ OS=Homo sapiens GN=RHOQ PE=1 SV=2 58 231 1.0E-46
sp|Q40220|RAC2_LOTJA Rac-like GTP-binding protein RAC2 OS=Lotus japonicus GN=RAC2 PE=2 SV=1 58 231 1.0E-46
sp|P92978|RAC11_ARATH Rac-like GTP-binding protein ARAC11 OS=Arabidopsis thaliana GN=ARAC11 PE=1 SV=2 58 231 2.0E-46
sp|Q6ZHA3|RAC6_ORYSJ Rac-like GTP-binding protein 6 OS=Oryza sativa subsp. japonica GN=RAC6 PE=2 SV=1 58 231 3.0E-46
sp|Q9SU67|RAC8_ARATH Rac-like GTP-binding protein ARAC8 OS=Arabidopsis thaliana GN=ARAC8 PE=1 SV=2 58 231 4.0E-46
sp|O82481|RAC10_ARATH Rac-like GTP-binding protein ARAC10 OS=Arabidopsis thaliana GN=ARAC10 PE=1 SV=1 58 231 4.0E-46
sp|O04369|RAC1_LOTJA Rac-like GTP-binding protein RAC1 OS=Lotus japonicus GN=RAC1 PE=2 SV=1 58 231 4.0E-46
sp|Q39435|RAC1_BETVU Rac-like GTP-binding protein RHO1 OS=Beta vulgaris GN=RHO1 PE=2 SV=1 58 231 4.0E-46
sp|Q38919|RAC4_ARATH Rac-like GTP-binding protein ARAC4 OS=Arabidopsis thaliana GN=ARAC4 PE=1 SV=1 58 231 5.0E-46
sp|Q00245|RHO3_YEAST GTP-binding protein RHO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO3 PE=1 SV=2 36 226 8.0E-46
sp|Q67VP4|RAC4_ORYSJ Rac-like GTP-binding protein 4 OS=Oryza sativa subsp. japonica GN=RAC4 PE=2 SV=1 58 231 8.0E-46
sp|Q38902|RAC1_ARATH Rac-like GTP-binding protein ARAC1 OS=Arabidopsis thaliana GN=ARAC1 PE=1 SV=1 58 231 9.0E-46
sp|P06781|RHO2_YEAST GTP-binding protein RHO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO2 PE=1 SV=2 57 226 1.0E-45
sp|Q35638|RHO1_PEA Rac-like GTP-binding protein RHO1 OS=Pisum sativum GN=RHO1 PE=2 SV=1 58 231 1.0E-45
sp|Q9SBJ6|RAC6_ARATH Rac-like GTP-binding protein ARAC6 OS=Arabidopsis thaliana GN=ARAC6 PE=1 SV=2 58 231 1.0E-45
sp|Q38937|RAC5_ARATH Rac-like GTP-binding protein ARAC5 OS=Arabidopsis thaliana GN=ARAC5 PE=1 SV=1 58 231 1.0E-45
sp|Q6EP31|RAC5_ORYSJ Rac-like GTP-binding protein 5 OS=Oryza sativa subsp. japonica GN=RAC5 PE=2 SV=2 58 231 3.0E-45
sp|Q9H4E5|RHOJ_HUMAN Rho-related GTP-binding protein RhoJ OS=Homo sapiens GN=RHOJ PE=1 SV=1 58 248 5.0E-45
sp|Q38912|RAC3_ARATH Rac-like GTP-binding protein ARAC3 OS=Arabidopsis thaliana GN=ARAC3 PE=1 SV=1 58 231 6.0E-45
sp|Q41253|RAC13_GOSHI Rac-like GTP-binding protein RAC13 OS=Gossypium hirsutum GN=RAC13 PE=2 SV=1 58 231 1.0E-44
sp|Q68Y52|RAC2_ORYSJ Rac-like GTP-binding protein 2 OS=Oryza sativa subsp. japonica GN=RAC2 PE=2 SV=1 58 239 1.0E-44
sp|Q41254|RAC9_GOSHI Rac-like GTP-binding protein RAC9 OS=Gossypium hirsutum GN=RAC9 PE=2 SV=1 58 231 1.0E-44
sp|Q38903|RAC2_ARATH Rac-like GTP-binding protein ARAC2 OS=Arabidopsis thaliana GN=ARAC2 PE=1 SV=1 58 231 2.0E-44
sp|Q9ER71|RHOJ_MOUSE Rho-related GTP-binding protein RhoJ OS=Mus musculus GN=Rhoj PE=1 SV=2 58 230 4.0E-44
sp|Q9GPS0|RACG_DICDI Rho-related protein racG OS=Dictyostelium discoideum GN=racG PE=3 SV=1 56 227 4.0E-44
sp|O82480|RAC7_ARATH Rac-like GTP-binding protein ARAC7 OS=Arabidopsis thaliana GN=ARAC7 PE=1 SV=1 58 238 9.0E-44
sp|Q24192|RHOL_DROME Ras-like GTP-binding protein RhoL OS=Drosophila melanogaster GN=RhoL PE=2 SV=1 48 230 1.0E-43
sp|Q9XGU0|RAC9_ARATH Rac-like GTP-binding protein ARAC9 OS=Arabidopsis thaliana GN=ARAC9 PE=1 SV=1 58 231 4.0E-43
sp|Q9HF51|RHO3_ASHGO GTP-binding protein RHO3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO3 PE=3 SV=1 57 226 6.0E-43
sp|Q9GPQ8|RACL_DICDI Rho-related protein racL OS=Dictyostelium discoideum GN=racL PE=3 SV=1 58 227 7.0E-43
sp|P52198|RND2_HUMAN Rho-related GTP-binding protein RhoN OS=Homo sapiens GN=RND2 PE=1 SV=2 58 211 1.0E-42
sp|Q9QYM5|RND2_MOUSE Rho-related GTP-binding protein RhoN OS=Mus musculus GN=Rnd2 PE=2 SV=1 58 211 2.0E-42
sp|Q9SSX0|RAC1_ORYSJ Rac-like GTP-binding protein 1 OS=Oryza sativa subsp. japonica GN=RAC1 PE=1 SV=1 52 231 4.0E-42
sp|P34147|RACA_DICDI Rho-related protein racA OS=Dictyostelium discoideum GN=racA PE=1 SV=2 58 252 3.0E-41
sp|P31021|RHO1_ENTHI Ras-like GTP-binding protein RHO1 OS=Entamoeba histolytica GN=RHO1 PE=3 SV=1 58 233 3.0E-41
sp|Q7L0Q8|RHOU_HUMAN Rho-related GTP-binding protein RhoU OS=Homo sapiens GN=RHOU PE=1 SV=1 58 245 1.0E-39
sp|Q2HJ68|RND1_BOVIN Rho-related GTP-binding protein Rho6 OS=Bos taurus GN=RND1 PE=2 SV=1 58 231 1.0E-39
sp|Q9EQT3|RHOU_MOUSE Rho-related GTP-binding protein RhoU OS=Mus musculus GN=Rhou PE=2 SV=1 58 228 2.0E-39
sp|Q92730|RND1_HUMAN Rho-related GTP-binding protein Rho6 OS=Homo sapiens GN=RND1 PE=1 SV=1 58 231 2.0E-39
sp|Q8BLR7|RND1_MOUSE Rho-related GTP-binding protein Rho6 OS=Mus musculus GN=Rnd1 PE=2 SV=1 58 231 3.0E-39
sp|A5D7J5|RHOU_BOVIN Rho-related GTP-binding protein RhoU OS=Bos taurus GN=RHOU PE=2 SV=1 58 245 1.0E-38
sp|Q9GPR7|RACH_DICDI Rho-related protein racH OS=Dictyostelium discoideum GN=racH PE=3 SV=1 58 231 4.0E-38
sp|P34150|RACD_DICDI Rho-related protein racD OS=Dictyostelium discoideum GN=racD PE=2 SV=3 70 221 5.0E-38
sp|Q54HZ7|RACM_DICDI Rho-related protein racM OS=Dictyostelium discoideum GN=racM PE=3 SV=2 58 227 9.0E-37
sp|Q17QI8|RHOV_BOVIN Rho-related GTP-binding protein RhoV OS=Bos taurus GN=Rhov PE=2 SV=1 50 236 3.0E-36
sp|Q9GPR2|RACI_DICDI Rho-related protein racI OS=Dictyostelium discoideum GN=racI PE=3 SV=1 58 227 3.0E-36
sp|Q9Z1Y0|RHOV_RAT Rho-related GTP-binding protein RhoV OS=Rattus norvegicus GN=Rhov PE=1 SV=1 58 236 6.0E-36
sp|Q8VDU1|RHOV_MOUSE Rho-related GTP-binding protein RhoV OS=Mus musculus GN=Rhov PE=2 SV=1 58 236 7.0E-36
sp|Q96L33|RHOV_HUMAN Rho-related GTP-binding protein RhoV OS=Homo sapiens GN=RHOV PE=1 SV=1 58 236 7.0E-36
sp|P53879|RHO5_YEAST GTP-binding protein RHO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO5 PE=1 SV=2 56 231 1.0E-35
sp|O94103|CDC42_COLGL Cell division control protein 42 homolog OS=Colletotrichum gloeosporioides GN=CDC42 PE=3 SV=1 58 228 2.0E-34
sp|Q54YY4|RACN_DICDI Rho-related protein racN OS=Dictyostelium discoideum GN=racN PE=3 SV=1 58 236 1.0E-32
sp|Q9D3G9|RHOH_MOUSE Rho-related GTP-binding protein RhoH OS=Mus musculus GN=Rhoh PE=1 SV=1 56 236 2.0E-31
sp|Q2HJG3|RHOH_BOVIN Rho-related GTP-binding protein RhoH OS=Bos taurus GN=RHOH PE=2 SV=1 56 227 6.0E-30
sp|Q15669|RHOH_HUMAN Rho-related GTP-binding protein RhoH OS=Homo sapiens GN=RHOH PE=1 SV=1 56 227 9.0E-30
sp|O94844|RHBT1_HUMAN Rho-related BTB domain-containing protein 1 OS=Homo sapiens GN=RHOBTB1 PE=2 SV=2 58 238 3.0E-23
sp|Q91V93|RHBT2_MOUSE Rho-related BTB domain-containing protein 2 OS=Mus musculus GN=Rhobtb2 PE=2 SV=2 58 238 6.0E-22
sp|Q9BYZ6|RHBT2_HUMAN Rho-related BTB domain-containing protein 2 OS=Homo sapiens GN=RHOBTB2 PE=2 SV=2 58 238 8.0E-22
sp|Q9DAK3|RHBT1_MOUSE Rho-related BTB domain-containing protein 1 OS=Mus musculus GN=Rhobtb1 PE=1 SV=2 58 238 9.0E-22
sp|Q9CB01|RABF1_ARATH Ras-related protein RABF1 OS=Arabidopsis thaliana GN=RABF1 PE=1 SV=1 33 225 3.0E-21
sp|P41924|RYL1_YARLI Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 58 254 4.0E-21
sp|P17609|YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 50 223 3.0E-20
sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 55 268 6.0E-20
sp|P07560|SEC4_YEAST Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 35 223 6.0E-20
sp|O42819|SEC4_CANGA Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 35 223 7.0E-20
sp|P34143|RABC_DICDI Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 58 224 7.0E-20
sp|Q9FPJ4|RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 55 243 1.0E-19
sp|Q9SEH3|RAD2C_ARATH Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 55 243 2.0E-19
sp|Q05737|YPTM2_MAIZE GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 55 223 2.0E-19
sp|P40392|RIC1_ORYSJ Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 55 263 7.0E-19
sp|Q17R06|RAB21_BOVIN Ras-related protein Rab-21 OS=Bos taurus GN=RAB21 PE=2 SV=1 54 252 8.0E-19
sp|P28186|RAE1C_ARATH Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 55 223 1.0E-18
sp|Q39433|RB1BV_BETVU Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 55 254 1.0E-18
sp|Q6AXT5|RAB21_RAT Ras-related protein Rab-21 OS=Rattus norvegicus GN=Rab21 PE=2 SV=1 55 252 2.0E-18
sp|P35282|RAB21_MOUSE Ras-related protein Rab-21 OS=Mus musculus GN=Rab21 PE=1 SV=4 55 252 2.0E-18
sp|P28188|RAD2A_ARATH Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 55 223 2.0E-18
sp|P34139|RAB1A_DICDI Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 55 268 2.0E-18
sp|P10536|RAB1B_RAT Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 55 260 2.0E-18
sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 55 260 3.0E-18
sp|Q2HJH2|RAB1B_BOVIN Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 55 260 3.0E-18
sp|P55745|RAB21_CANLF Ras-related protein Rab-21 OS=Canis lupus familiaris GN=RAB21 PE=3 SV=3 54 255 3.0E-18
sp|Q5RE13|RAB1B_PONAB Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 55 260 4.0E-18
sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 55 260 4.0E-18
sp|P34140|RAB1B_DICDI Ras-related protein Rab-1B OS=Dictyostelium discoideum GN=rab1B PE=2 SV=2 55 271 5.0E-18
sp|Q4R8X3|RAB1B_MACFA Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 55 260 5.0E-18
sp|O24466|RAE1A_ARATH Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 55 223 6.0E-18
sp|Q9UL25|RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 55 252 7.0E-18
sp|Q2HJI8|RAB8B_BOVIN Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 55 271 9.0E-18
sp|P70550|RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 55 271 1.0E-17
sp|P61028|RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 55 271 1.0E-17
sp|P80236|RAC1_CAVPO Ras-related C3 botulinum toxin substrate 1 (Fragment) OS=Cavia porcellus GN=RAC1 PE=1 SV=2 151 227 1.0E-17
sp|Q5U316|RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 58 268 2.0E-17
sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 58 268 2.0E-17
sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 58 268 2.0E-17
sp|Q9GPQ9|RACJ_DICDI Rho-related protein racJ OS=Dictyostelium discoideum GN=racJ PE=3 SV=1 58 229 2.0E-17
sp|Q5REC9|RAB8B_PONAB Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 55 271 2.0E-17
sp|Q92930|RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 55 271 2.0E-17
sp|Q06AU7|RAB1B_PIG Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 55 260 2.0E-17
sp|O00194|RB27B_HUMAN Ras-related protein Rab-27B OS=Homo sapiens GN=RAB27B PE=1 SV=4 55 264 2.0E-17
sp|P31584|YPTV1_VOLCA GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 55 223 3.0E-17
sp|Q92928|RAB1C_HUMAN Putative Ras-related protein Rab-1C OS=Homo sapiens GN=RAB1C PE=5 SV=2 58 260 3.0E-17
sp|Q9ZRE2|RABD1_ARATH Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1 55 268 4.0E-17
sp|Q05974|RAB1A_LYMST Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 55 223 4.0E-17
sp|P11620|YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 55 256 5.0E-17
sp|O76173|RAB1C_DICDI Ras-related protein Rab-1C OS=Dictyostelium discoideum GN=Rab1C PE=2 SV=1 58 223 5.0E-17
sp|Q8WQ53|RAB21_GEOCY Ras-related protein Rab-21 OS=Geodia cydonium GN=RAB21 PE=2 SV=1 54 233 7.0E-17
sp|Q39571|YPTC1_CHLRE GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 55 250 8.0E-17
sp|P40393|RIC2_ORYSJ Ras-related protein RIC2 OS=Oryza sativa subsp. japonica GN=RIC2 PE=2 SV=2 55 249 8.0E-17
sp|P0CY30|SEC4_CANAX Ras-related protein SEC4 OS=Candida albicans GN=SEC4 PE=3 SV=1 58 223 9.0E-17
sp|C4YL11|SEC4_CANAW Ras-related protein SEC4 OS=Candida albicans (strain WO-1) GN=SEC4 PE=3 SV=1 58 223 9.0E-17
sp|P0CY31|SEC4_CANAL Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC4 PE=3 SV=1 58 223 9.0E-17
sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 55 259 9.0E-17
sp|Q40723|RLGP2_ORYSJ Ras-related protein RGP2 OS=Oryza sativa subsp. japonica GN=RGP2 PE=2 SV=2 54 227 1.0E-16
sp|P25228|RAB3_DROME Ras-related protein Rab-3 OS=Drosophila melanogaster GN=Rab3 PE=1 SV=1 55 252 2.0E-16
sp|Q9R0M6|RAB9A_MOUSE Ras-related protein Rab-9A OS=Mus musculus GN=Rab9a PE=1 SV=1 58 238 2.0E-16
sp|Q9DD03|RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 58 268 2.0E-16
sp|Q40195|RB11E_LOTJA Ras-related protein Rab11E OS=Lotus japonicus GN=RAB11E PE=2 SV=1 55 247 2.0E-16
sp|P29687|RAB5_TOBAC Ras-related protein Rab5 OS=Nicotiana tabacum GN=RAB5 PE=2 SV=1 58 223 2.0E-16
sp|Q39434|RB2BV_BETVU Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 55 268 2.0E-16
sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 55 264 3.0E-16
sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 55 264 3.0E-16
sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 55 264 3.0E-16
sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 55 264 3.0E-16
sp|P62822|RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 55 264 3.0E-16
sp|P38545|RAN_PLAFA GTP-binding nuclear protein Ran OS=Plasmodium falciparum PE=2 SV=1 53 175 3.0E-16
sp|F1PTE3|RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 58 223 3.0E-16
sp|Q99P75|RAB9A_RAT Ras-related protein Rab-9A OS=Rattus norvegicus GN=Rab9a PE=1 SV=2 58 236 3.0E-16
sp|P59190|RAB15_HUMAN Ras-related protein Rab-15 OS=Homo sapiens GN=RAB15 PE=1 SV=1 58 240 3.0E-16
sp|P36861|YPTV2_VOLCA GTP-binding protein yptV2 OS=Volvox carteri GN=YPTV2 PE=3 SV=1 58 234 3.0E-16
sp|Q923S9|RAB30_MOUSE Ras-related protein Rab-30 OS=Mus musculus GN=Rab30 PE=1 SV=1 58 253 4.0E-16
sp|Q15771|RAB30_HUMAN Ras-related protein Rab-30 OS=Homo sapiens GN=RAB30 PE=1 SV=2 58 253 4.0E-16
sp|Q17QB7|RAB30_BOVIN Ras-related protein Rab-30 OS=Bos taurus GN=RAB30 PE=2 SV=1 58 253 4.0E-16
sp|P20790|RAB8A_DICDI Ras-related protein Rab-8A OS=Dictyostelium discoideum GN=rab8A PE=3 SV=1 44 223 4.0E-16
sp|P35280|RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 55 271 4.0E-16
sp|P55258|RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 55 271 4.0E-16
sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 55 223 5.0E-16
sp|Q5KTJ6|RAB13_MESAU Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 58 223 5.0E-16
sp|Q54NU2|RAB1D_DICDI Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 58 240 6.0E-16
sp|P51153|RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 58 246 6.0E-16
sp|Q1RMR4|RAB15_BOVIN Ras-related protein Rab-15 OS=Bos taurus GN=RAB15 PE=2 SV=1 58 240 7.0E-16
sp|P18613|RAPA_DICDI Ras-related protein rapA OS=Dictyostelium discoideum GN=rapA PE=1 SV=1 53 247 7.0E-16
sp|Q8K386|RAB15_MOUSE Ras-related protein Rab-15 OS=Mus musculus GN=Rab15 PE=1 SV=1 58 248 7.0E-16
sp|Q58DS5|RAB13_BOVIN Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 58 223 7.0E-16
sp|Q8BHD0|RB39A_MOUSE Ras-related protein Rab-39A OS=Mus musculus GN=Rab39a PE=1 SV=1 55 223 8.0E-16
sp|Q39222|RAA1B_ARATH Ras-related protein RABA1b OS=Arabidopsis thaliana GN=RABA1B PE=2 SV=1 55 248 8.0E-16
sp|P35289|RAB15_RAT Ras-related protein Rab-15 OS=Rattus norvegicus GN=Rab15 PE=2 SV=1 58 248 8.0E-16
sp|Q94694|RAP1_PHYPO Ras-related protein Rap-1 OS=Physarum polycephalum GN=RAP1 PE=2 SV=1 53 250 9.0E-16
sp|Q5R4A3|RAB8A_PONAB Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 55 271 1.0E-15
sp|Q18246|RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans GN=rap-1 PE=3 SV=1 58 241 1.0E-15
sp|A4FV54|RAB8A_BOVIN Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 55 271 1.0E-15
sp|P31583|RHN1_NICPL Ras-related protein RHN1 OS=Nicotiana plumbaginifolia GN=RHN1 PE=2 SV=1 58 223 1.0E-15
sp|Q4R5P1|RAB8A_MACFA Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 55 271 1.0E-15
sp|P61006|RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 55 271 1.0E-15
sp|P61007|RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 55 271 1.0E-15
sp|O49841|RAC2A_ARATH Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 36 231 2.0E-15
sp|Q5F470|RAB8A_CHICK Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 55 271 2.0E-15
sp|Q99P58|RB27B_MOUSE Ras-related protein Rab-27B OS=Mus musculus GN=Rab27b PE=1 SV=3 55 268 2.0E-15
sp|Q40194|RB11D_LOTJA Ras-related protein Rab11D OS=Lotus japonicus GN=RAB11D PE=2 SV=1 55 247 2.0E-15
sp|Q96DA2|RB39B_HUMAN Ras-related protein Rab-39B OS=Homo sapiens GN=RAB39B PE=1 SV=1 55 223 2.0E-15
sp|Q8BHC1|RB39B_MOUSE Ras-related protein Rab-39B OS=Mus musculus GN=Rab39b PE=1 SV=1 55 223 2.0E-15
sp|Q17QU4|RB39B_BOVIN Ras-related protein Rab-39B OS=Bos taurus GN=RAB39B PE=2 SV=1 55 223 2.0E-15
sp|O04486|RAA2A_ARATH Ras-related protein RABA2a OS=Arabidopsis thaliana GN=RABA2A PE=2 SV=1 55 224 2.0E-15
sp|Q9SJ11|RABG2_ARATH Ras-related protein RABG2 OS=Arabidopsis thaliana GN=RABG2 PE=2 SV=2 58 236 3.0E-15
sp|Q54Z85|RACO_DICDI Rho-related protein racO OS=Dictyostelium discoideum GN=racO PE=3 SV=1 58 233 3.0E-15
sp|P16976|YPTM1_MAIZE GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 55 223 3.0E-15
sp|Q8HZJ5|RB27B_BOVIN Ras-related protein Rab-27B OS=Bos taurus GN=RAB27B PE=2 SV=3 55 264 3.0E-15
sp|P24408|RAB9A_CANLF Ras-related protein Rab-9A OS=Canis lupus familiaris GN=RAB9A PE=1 SV=2 58 237 3.0E-15
sp|Q96283|RAA2C_ARATH Ras-related protein RABA2c OS=Arabidopsis thaliana GN=RABA2C PE=2 SV=4 55 224 3.0E-15
sp|P51151|RAB9A_HUMAN Ras-related protein Rab-9A OS=Homo sapiens GN=RAB9A PE=1 SV=1 58 237 3.0E-15
sp|Q7T3A4|RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 58 223 4.0E-15
sp|P35286|RAB13_RAT Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 58 223 5.0E-15
sp|Q86JP3|RAB5A_DICDI Ras-related protein Rab-5A OS=Dictyostelium discoideum GN=rab5A PE=3 SV=1 55 223 5.0E-15
sp|P22128|RAB8_DIPOM Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 55 223 5.0E-15
sp|Q14964|RB39A_HUMAN Ras-related protein Rab-39A OS=Homo sapiens GN=RAB39A PE=1 SV=2 55 223 6.0E-15
sp|P20791|RAB8B_DICDI Ras-related protein Rab-8B OS=Dictyostelium discoideum GN=rab8B PE=2 SV=1 58 223 6.0E-15
sp|Q8BHH2|RAB9B_MOUSE Ras-related protein Rab-9B OS=Mus musculus GN=Rab9b PE=1 SV=1 58 232 7.0E-15
sp|P36017|VPS21_YEAST Vacuolar protein sorting-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS21 PE=1 SV=1 56 223 7.0E-15
sp|Q9LNW1|RAA2B_ARATH Ras-related protein RABA2b OS=Arabidopsis thaliana GN=RABA2B PE=2 SV=2 55 224 8.0E-15
sp|Q01111|YPT3_NICPL Ras-related protein YPT3 OS=Nicotiana plumbaginifolia GN=YPT3 PE=2 SV=1 55 247 9.0E-15
sp|Q54GY8|RAB18_DICDI Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 58 225 9.0E-15
sp|Q5R4W9|RAB9B_PONAB Ras-related protein Rab-9B OS=Pongo abelii GN=RAB9B PE=2 SV=1 58 232 9.0E-15
sp|Q01387|RAS2_NEUCR Protein ras-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-2 PE=3 SV=2 58 271 1.0E-14
sp|Q9LV79|RAH1A_ARATH Ras-related protein RABH1a OS=Arabidopsis thaliana GN=RABH1A PE=2 SV=1 58 223 1.0E-14
sp|P17610|YPT3_SCHPO GTP-binding protein ypt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt3 PE=1 SV=1 55 269 1.0E-14
sp|Q9S810|RAA1I_ARATH Ras-related protein RABA1i OS=Arabidopsis thaliana GN=RABA1I PE=2 SV=1 55 261 1.0E-14
sp|Q55CB9|RASV_DICDI Ras-like protein rasV OS=Dictyostelium discoideum GN=rasV PE=3 SV=1 58 230 1.0E-14
sp|P41914|RAN_TETPY GTP-binding nuclear protein Ran OS=Tetrahymena pyriformis PE=2 SV=1 58 173 1.0E-14
sp|P19892|RAA5E_ARATH Ras-related protein RABA5e OS=Arabidopsis thaliana GN=RABA5E PE=2 SV=1 55 238 1.0E-14
sp|Q54FK8|RABM_DICDI Ras-related protein RabM OS=Dictyostelium discoideum GN=rabM PE=3 SV=2 56 239 1.0E-14
sp|P51159|RB27A_HUMAN Ras-related protein Rab-27A OS=Homo sapiens GN=RAB27A PE=1 SV=3 55 236 1.0E-14
sp|Q40521|RB11B_TOBAC Ras-related protein Rab11B OS=Nicotiana tabacum GN=RAB11B PE=2 SV=1 55 268 1.0E-14
sp|P01120|RAS2_YEAST Ras-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAS2 PE=1 SV=4 69 223 2.0E-14
sp|Q9SN68|RAF2B_ARATH Ras-related protein RABF2b OS=Arabidopsis thaliana GN=RABF2B PE=1 SV=1 54 223 2.0E-14
sp|Q92963|RIT1_HUMAN GTP-binding protein Rit1 OS=Homo sapiens GN=RIT1 PE=1 SV=1 58 266 2.0E-14
sp|Q54FK7|RABL_DICDI Ras-related protein RabL OS=Dictyostelium discoideum GN=rabL PE=3 SV=1 58 226 2.0E-14
sp|P28187|RAA5C_ARATH Ras-related protein RABA5c OS=Arabidopsis thaliana GN=RABA5C PE=1 SV=1 55 238 2.0E-14
sp|Q9FIF9|RAA2D_ARATH Ras-related protein RABA2d OS=Arabidopsis thaliana GN=RABA2D PE=2 SV=1 55 224 2.0E-14
sp|Q99P74|RB27B_RAT Ras-related protein Rab-27B OS=Rattus norvegicus GN=Rab27b PE=2 SV=3 55 268 3.0E-14
sp|O49513|RAA1E_ARATH Ras-related protein RABA1e OS=Arabidopsis thaliana GN=RABA1E PE=2 SV=1 55 251 3.0E-14
sp|Q9SF91|RAE1E_ARATH Ras-related protein RABE1e OS=Arabidopsis thaliana GN=RABE1E PE=1 SV=1 55 223 3.0E-14
sp|P28185|RAA1A_ARATH Ras-related protein RABA1a OS=Arabidopsis thaliana GN=RABA1A PE=1 SV=1 51 257 4.0E-14
sp|Q9NP90|RAB9B_HUMAN Ras-related protein Rab-9B OS=Homo sapiens GN=RAB9B PE=1 SV=1 58 232 4.0E-14
sp|P22124|RAL_DIPOM Ras-related protein O-RAL OS=Diplobatis ommata PE=2 SV=1 58 246 5.0E-14
sp|O23657|RABC1_ARATH Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 55 253 5.0E-14
sp|P23175|RASH_MSVNS GTPase HRas OS=Murine sarcoma virus NS.C58 GN=H-RAS PE=3 SV=1 58 223 5.0E-14
sp|Q94986|RAB3_CAEEL Ras-related protein Rab-3 OS=Caenorhabditis elegans GN=rab-3 PE=2 SV=1 55 268 6.0E-14
sp|Q9TVU5|RAB1_THEPA Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 55 264 6.0E-14
sp|Q9FK68|RAA1C_ARATH Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=2 SV=1 55 268 6.0E-14
sp|Q9ULW5|RAB26_HUMAN Ras-related protein Rab-26 OS=Homo sapiens GN=RAB26 PE=1 SV=3 58 223 6.0E-14
sp|Q9VND8|RHEB_DROME GTP-binding protein Rheb homolog OS=Drosophila melanogaster GN=Rheb PE=2 SV=1 53 242 6.0E-14
sp|Q40193|RB11C_LOTJA Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1 55 224 6.0E-14
sp|P32836|GSP2_YEAST GTP-binding nuclear protein GSP2/CNR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSP2 PE=1 SV=1 51 178 8.0E-14
sp|P51539|RAS1_HYDVU Ras-like protein RAS1 OS=Hydra vulgaris GN=RAS1 PE=2 SV=2 69 271 8.0E-14
sp|Q0WQN4|RAA6B_ARATH Ras-related protein RABA6b OS=Arabidopsis thaliana GN=RABA6B PE=2 SV=2 55 247 9.0E-14
sp|P01123|YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 55 178 1.0E-13
sp|P01115|RASH_MSVHA Transforming protein p29 OS=Harvey murine sarcoma virus GN=H-RAS PE=1 SV=1 19 223 1.0E-13
sp|Q40523|RB11A_TOBAC Ras-related protein Rab11A OS=Nicotiana tabacum GN=RAB11A PE=2 SV=1 55 224 1.0E-13
sp|P41915|RAN_TETTH GTP-binding nuclear protein Ran OS=Tetrahymena thermophila PE=2 SV=1 58 178 1.0E-13
sp|Q9VUN3|RANL_DROME GTP-binding nuclear protein Ran-like OS=Drosophila melanogaster GN=Ran-like PE=1 SV=1 58 233 1.0E-13
sp|P32835|GSP1_YEAST GTP-binding nuclear protein GSP1/CNR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSP1 PE=1 SV=1 51 178 1.0E-13
sp|O04157|RAG3B_ARATH Ras-related protein RABG3b OS=Arabidopsis thaliana GN=RABG3B PE=1 SV=1 58 248 1.0E-13
sp|P13856|RSR1_YEAST Ras-related protein RSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSR1 PE=3 SV=1 58 238 1.0E-13
sp|P32254|RASS_DICDI Ras-like protein rasS OS=Dictyostelium discoideum GN=rasS PE=2 SV=1 55 271 1.0E-13
sp|P36863|YPTV4_VOLCA GTP-binding protein yptV4 OS=Volvox carteri GN=YPTV4 PE=3 SV=1 55 223 1.0E-13
sp|P23640|RB27A_RAT Ras-related protein Rab-27A OS=Rattus norvegicus GN=Rab27a PE=1 SV=1 55 236 2.0E-13
sp|Q9SIP0|RAA5D_ARATH Ras-related protein RABA5d OS=Arabidopsis thaliana GN=RABA5D PE=1 SV=1 55 238 2.0E-13
sp|Q9HDY0|YPT71_SCHPO GTP-binding protein ypt71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt71 PE=3 SV=1 58 234 2.0E-13
sp|Q6FR65|GSP1_CANGA GTP-binding nuclear protein GSP1/Ran OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GSP1 PE=3 SV=1 51 178 2.0E-13
sp|Q9SRS5|RAA5B_ARATH Ras-related protein RABA5b OS=Arabidopsis thaliana GN=RABA5B PE=2 SV=1 55 236 2.0E-13
sp|P51156|RAB26_RAT Ras-related protein Rab-26 OS=Rattus norvegicus GN=Rab26 PE=2 SV=2 58 223 2.0E-13
sp|P22129|RB11B_DIPOM Ras-related protein Rab-11B OS=Diplobatis ommata PE=2 SV=1 55 227 2.0E-13
sp|Q4UB16|RAB1_THEAN Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 55 223 2.0E-13
sp|P51147|RAB5C_CANLF Ras-related protein Rab-5C OS=Canis lupus familiaris GN=RAB5C PE=2 SV=1 58 249 2.0E-13
sp|P01113|RASH_MSVMO GTPase HRas OS=Moloney murine sarcoma virus GN=H-RAS PE=3 SV=1 58 223 2.0E-13
sp|Q39570|YPTC4_CHLRE GTP-binding protein YPTC4 OS=Chlamydomonas reinhardtii GN=YPTC4 PE=3 SV=1 55 223 2.0E-13
sp|P46638|RB11B_MOUSE Ras-related protein Rab-11B OS=Mus musculus GN=Rab11b PE=1 SV=3 55 227 2.0E-13
sp|O35509|RB11B_RAT Ras-related protein Rab-11B OS=Rattus norvegicus GN=Rab11b PE=1 SV=4 55 227 2.0E-13
sp|Q15907|RB11B_HUMAN Ras-related protein Rab-11B OS=Homo sapiens GN=RAB11B PE=1 SV=4 55 227 2.0E-13
sp|Q3MHP2|RB11B_BOVIN Ras-related protein Rab-11B OS=Bos taurus GN=RAB11B PE=2 SV=3 55 227 2.0E-13
sp|Q74ZA9|GSP1_ASHGO GTP-binding nuclear protein GSP1/Ran OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GSP1 PE=3 SV=1 51 178 2.0E-13
sp|Q9SN35|RAA1D_ARATH Ras-related protein RABA1d OS=Arabidopsis thaliana GN=RABA1D PE=2 SV=1 55 227 2.0E-13
sp|P52301|RAN_XENLA GTP-binding nuclear protein Ran OS=Xenopus laevis GN=ran PE=1 SV=2 53 178 2.0E-13
sp|Q9LZD4|RAE1D_ARATH Ras-related protein RABE1d OS=Arabidopsis thaliana GN=RABE1D PE=1 SV=1 55 223 2.0E-13
sp|P35276|RAB3D_MOUSE Ras-related protein Rab-3D OS=Mus musculus GN=Rab3d PE=1 SV=1 55 250 2.0E-13
sp|Q38922|RAB1B_ARATH Ras-related protein RABB1b OS=Arabidopsis thaliana GN=RABB1B PE=2 SV=1 55 256 2.0E-13
sp|Q6GL85|RAN_XENTR GTP-binding nuclear protein Ran OS=Xenopus tropicalis GN=ran PE=2 SV=1 53 178 2.0E-13
sp|P42558|RAN_CHICK GTP-binding nuclear protein Ran OS=Gallus gallus GN=RAN PE=2 SV=1 53 178 2.0E-13
sp|Q9C9U7|RAA6A_ARATH Ras-related protein RABA6a OS=Arabidopsis thaliana GN=RABA6A PE=2 SV=1 55 223 3.0E-13
sp|Q9FJH0|RAA1F_ARATH Ras-related protein RABA1f OS=Arabidopsis thaliana GN=RABA1F PE=2 SV=1 55 251 3.0E-13
sp|P62828|RAN_RAT GTP-binding nuclear protein Ran OS=Rattus norvegicus GN=Ran PE=1 SV=3 53 178 3.0E-13
sp|Q5R556|RAN_PONAB GTP-binding nuclear protein Ran OS=Pongo abelii GN=RAN PE=2 SV=3 53 178 3.0E-13
sp|P62827|RAN_MOUSE GTP-binding nuclear protein Ran OS=Mus musculus GN=Ran PE=1 SV=3 53 178 3.0E-13
sp|Q4R4M9|RAN_MACFA GTP-binding nuclear protein Ran OS=Macaca fascicularis GN=RAN PE=2 SV=3 53 178 3.0E-13
sp|P62826|RAN_HUMAN GTP-binding nuclear protein Ran OS=Homo sapiens GN=RAN PE=1 SV=3 53 178 3.0E-13
sp|P62825|RAN_CANLF GTP-binding nuclear protein Ran OS=Canis lupus familiaris GN=RAN PE=1 SV=3 53 178 3.0E-13
sp|Q3T054|RAN_BOVIN GTP-binding nuclear protein Ran OS=Bos taurus GN=RAN PE=2 SV=3 53 178 3.0E-13
sp|Q504M8|RAB26_MOUSE Ras-related protein Rab-26 OS=Mus musculus GN=Rab26 PE=1 SV=1 58 223 3.0E-13
sp|P22126|RAS1_NEUCR Protein ras-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-1 PE=2 SV=1 67 256 3.0E-13
sp|P38542|RAN_BRUMA GTP-binding nuclear protein Ran OS=Brugia malayi GN=Bm1_44725 PE=2 SV=2 51 178 3.0E-13
sp|Q9ULC3|RAB23_HUMAN Ras-related protein Rab-23 OS=Homo sapiens GN=RAB23 PE=1 SV=1 58 225 3.0E-13
sp|Q9ERI2|RB27A_MOUSE Ras-related protein Rab-27A OS=Mus musculus GN=Rab27a PE=1 SV=1 55 231 3.0E-13
sp|Q2TA29|RB11A_BOVIN Ras-related protein Rab-11A OS=Bos taurus GN=RAB11A PE=2 SV=3 55 224 3.0E-13
sp|Q5ZJN2|RB11A_CHICK Ras-related protein Rab-11A OS=Gallus gallus GN=RAB11A PE=2 SV=1 55 224 3.0E-13
sp|Q96AX2|RAB37_HUMAN Ras-related protein Rab-37 OS=Homo sapiens GN=RAB37 PE=1 SV=3 52 223 4.0E-13
sp|Q39572|YPTC6_CHLRE Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1 55 227 4.0E-13
sp|P62494|RB11A_RAT Ras-related protein Rab-11A OS=Rattus norvegicus GN=Rab11a PE=1 SV=3 55 224 4.0E-13
sp|P62493|RB11A_RABIT Ras-related protein Rab-11A OS=Oryctolagus cuniculus GN=RAB11A PE=2 SV=3 55 224 4.0E-13
sp|Q5R9M7|RB11A_PONAB Ras-related protein Rab-11A OS=Pongo abelii GN=RAB11A PE=2 SV=3 55 224 4.0E-13
sp|Q52NJ1|RB11A_PIG Ras-related protein Rab-11A OS=Sus scrofa GN=RAB11A PE=2 SV=3 55 224 4.0E-13
sp|P62492|RB11A_MOUSE Ras-related protein Rab-11A OS=Mus musculus GN=Rab11a PE=1 SV=3 55 224 4.0E-13
sp|P62491|RB11A_HUMAN Ras-related protein Rab-11A OS=Homo sapiens GN=RAB11A PE=1 SV=3 55 224 4.0E-13
sp|P62490|RB11A_CANLF Ras-related protein Rab-11A OS=Canis lupus familiaris GN=RAB11A PE=2 SV=3 55 224 4.0E-13
sp|P63320|RALA_SAGOE Ras-related protein Ral-A OS=Saguinus oedipus GN=RALA PE=1 SV=1 58 223 4.0E-13
sp|P63322|RALA_RAT Ras-related protein Ral-A OS=Rattus norvegicus GN=Rala PE=1 SV=1 58 223 4.0E-13
sp|P63321|RALA_MOUSE Ras-related protein Ral-A OS=Mus musculus GN=Rala PE=1 SV=1 58 223 4.0E-13
sp|Q7ZZX9|RAN_CARAU GTP-binding nuclear protein Ran OS=Carassius auratus GN=ran PE=2 SV=1 53 178 4.0E-13
sp|P34141|RABA_DICDI Ras-related protein RabA OS=Dictyostelium discoideum GN=rabA PE=2 SV=2 58 223 4.0E-13
sp|Q9YGC0|RAN_SALSA GTP-binding nuclear protein Ran OS=Salmo salar GN=ran PE=2 SV=1 53 178 5.0E-13
sp|P79735|RAN_DANRE GTP-binding nuclear protein Ran OS=Danio rerio GN=ran PE=2 SV=1 53 178 5.0E-13
sp|O17915|RAN_CAEEL GTP-binding nuclear protein ran-1 OS=Caenorhabditis elegans GN=ran-1 PE=1 SV=1 53 178 5.0E-13
sp|P35278|RAB5C_MOUSE Ras-related protein Rab-5C OS=Mus musculus GN=Rab5c PE=1 SV=2 58 249 5.0E-13
sp|Q9LK99|RAA1G_ARATH Ras-related protein RABA1g OS=Arabidopsis thaliana GN=RABA1G PE=2 SV=1 58 223 5.0E-13
sp|P53994|RAB2A_MOUSE Ras-related protein Rab-2A OS=Mus musculus GN=Rab2a PE=1 SV=1 52 223 5.0E-13
sp|P61107|RAB14_RAT Ras-related protein Rab-14 OS=Rattus norvegicus GN=Rab14 PE=1 SV=3 54 268 5.0E-13
sp|Q52NJ6|RAB14_PIG Ras-related protein Rab-14 OS=Sus scrofa GN=RAB14 PE=2 SV=3 54 268 5.0E-13
sp|P63012|RAB3A_RAT Ras-related protein Rab-3A OS=Rattus norvegicus GN=Rab3a PE=1 SV=1 55 230 5.0E-13
sp|Q06AU3|RAB3A_PIG Ras-related protein Rab-3A OS=Sus scrofa GN=RAB3A PE=2 SV=1 55 230 5.0E-13
sp|P63011|RAB3A_MOUSE Ras-related protein Rab-3A OS=Mus musculus GN=Rab3a PE=1 SV=1 55 230 5.0E-13
sp|Q4R4R9|RAB3A_MACFA Ras-related protein Rab-3A OS=Macaca fascicularis GN=RAB3A PE=2 SV=1 55 230 5.0E-13
sp|P20336|RAB3A_HUMAN Ras-related protein Rab-3A OS=Homo sapiens GN=RAB3A PE=1 SV=1 55 230 5.0E-13
sp|Q5R8Z8|RAB14_PONAB Ras-related protein Rab-14 OS=Pongo abelii GN=RAB14 PE=2 SV=3 54 268 5.0E-13
sp|Q91V41|RAB14_MOUSE Ras-related protein Rab-14 OS=Mus musculus GN=Rab14 PE=1 SV=3 54 268 5.0E-13
sp|P61106|RAB14_HUMAN Ras-related protein Rab-14 OS=Homo sapiens GN=RAB14 PE=1 SV=4 54 268 5.0E-13
sp|Q5ZKU5|RAB14_CHICK Ras-related protein Rab-14 OS=Gallus gallus GN=RAB14 PE=2 SV=3 54 268 5.0E-13
sp|Q1HE58|RB27A_CANLF Ras-related protein Rab-27A OS=Canis lupus familiaris GN=RAB27A PE=2 SV=1 55 231 5.0E-13
sp|P11023|RAB3A_BOVIN Ras-related protein Rab-3A OS=Bos taurus GN=RAB3A PE=1 SV=3 55 230 6.0E-13
sp|P01114|RASH_RRASV Transforming protein p29 OS=Rasheed rat sarcoma virus GN=RAS PE=3 SV=1 58 223 6.0E-13
sp|Q96E17|RAB3C_HUMAN Ras-related protein Rab-3C OS=Homo sapiens GN=RAB3C PE=2 SV=1 55 255 6.0E-13
sp|Q99260|YPT6_YEAST GTP-binding protein YPT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT6 PE=1 SV=1 58 224 6.0E-13
sp|P35294|RAB19_MOUSE Ras-related protein Rab-19 OS=Mus musculus GN=Rab19 PE=1 SV=3 38 223 6.0E-13
sp|Q54DA7|RAB4_DICDI Ras-related protein Rab-4 OS=Dictyostelium discoideum GN=rab4 PE=3 SV=1 53 257 6.0E-13
sp|P10949|RAB3C_BOVIN Ras-related protein Rab-3C OS=Bos taurus GN=RAB3C PE=2 SV=3 55 255 7.0E-13
sp|P33519|RAN_DICDI GTP-binding nuclear protein Ran OS=Dictyostelium discoideum GN=ranA PE=1 SV=1 58 178 7.0E-13
sp|Q63942|RAB3D_RAT GTP-binding protein Rab-3D OS=Rattus norvegicus GN=Rab3d PE=1 SV=2 55 250 8.0E-13
sp|Q01971|RAB2A_RABIT Ras-related protein Rab-2A OS=Oryctolagus cuniculus GN=RAB2A PE=2 SV=1 52 223 8.0E-13
sp|Q4LE85|RB27A_PIG Ras-related protein Rab-27A OS=Sus scrofa GN=RAB27A PE=2 SV=1 55 256 8.0E-13
sp|Q5R6B6|RAB2A_PONAB Ras-related protein Rab-2A OS=Pongo abelii GN=RAB2A PE=2 SV=1 52 223 8.0E-13
sp|Q4R4X6|RAB2A_MACFA Ras-related protein Rab-2A OS=Macaca fascicularis GN=RAB2A PE=2 SV=1 52 223 8.0E-13
sp|P61019|RAB2A_HUMAN Ras-related protein Rab-2A OS=Homo sapiens GN=RAB2A PE=1 SV=1 52 223 8.0E-13
sp|Q90965|RAB2A_CHICK Ras-related protein Rab-2A OS=Gallus gallus GN=RAB2A PE=2 SV=1 52 223 8.0E-13
sp|P61105|RAB2A_CANLF Ras-related protein Rab-2A OS=Canis lupus familiaris GN=RAB2A PE=1 SV=1 52 223 8.0E-13
sp|P01117|RASK_MSVKI GTPase KRas OS=Kirsten murine sarcoma virus GN=K-RAS PE=1 SV=1 58 223 8.0E-13
sp|Q54FL2|RABG2_DICDI Ras-related protein RabG2 OS=Dictyostelium discoideum GN=rabG2 PE=3 SV=2 58 245 8.0E-13
sp|Q9VZ23|RAN_DROME GTP-binding nuclear protein Ran OS=Drosophila melanogaster GN=Ran PE=1 SV=1 51 178 8.0E-13
sp|Q9FLQ3|RAN4_ARATH GTP-binding nuclear protein Ran-4 OS=Arabidopsis thaliana GN=RAN4 PE=3 SV=1 48 174 9.0E-13
sp|O23561|RAB1A_ARATH Ras-related protein RABB1a OS=Arabidopsis thaliana GN=RABB1A PE=2 SV=1 55 223 9.0E-13
sp|Q9P4E9|GSP1_CANAW GTP-binding nuclear protein GSP1/Ran OS=Candida albicans (strain WO-1) GN=GSP1 PE=3 SV=2 51 178 9.0E-13
sp|P90726|RAB18_CAEBR Ras-related protein Rab-18 OS=Caenorhabditis briggsae GN=rab-18 PE=3 SV=1 52 250 9.0E-13
sp|Q5M7U5|RAB19_RAT Ras-related protein Rab-19 OS=Rattus norvegicus GN=Rab19 PE=2 SV=1 43 223 1.0E-12
sp|Q95UJ0|RAB7A_PAROT Ras-related protein Rab-7a OS=Paramecium octaurelia GN=Rab7a PE=1 SV=2 58 173 1.0E-12
sp|Q69XM7|RAN3_ORYSJ GTP-binding nuclear protein Ran-3 OS=Oryza sativa subsp. japonica GN=RAN3 PE=2 SV=1 56 178 1.0E-12
sp|A2YEQ6|RAN3_ORYSI GTP-binding nuclear protein Ran-3 OS=Oryza sativa subsp. indica GN=RAN3 PE=2 SV=2 56 178 1.0E-12
sp|O97572|RAB7A_RABIT Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1 58 224 1.0E-12
sp|Q6DUB4|RAB7B_PAROT Ras-related protein Rab-7b OS=Paramecium octaurelia GN=Rab7b PE=1 SV=1 58 173 1.0E-12
sp|P01119|RAS1_YEAST Ras-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAS1 PE=1 SV=2 69 230 1.0E-12
sp|Q8WUD1|RAB2B_HUMAN Ras-related protein Rab-2B OS=Homo sapiens GN=RAB2B PE=1 SV=1 55 223 1.0E-12
sp|P05712|RAB2A_RAT Ras-related protein Rab-2A OS=Rattus norvegicus GN=Rab2a PE=2 SV=1 52 223 1.0E-12
sp|P17608|RYH1_SCHPO GTP-binding protein ryh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ryh1 PE=1 SV=1 58 223 1.0E-12
sp|Q05975|RAB2_LYMST Ras-related protein Rab-2 OS=Lymnaea stagnalis GN=RAB2 PE=2 SV=1 55 223 2.0E-12
sp|Q6TEN1|RAP1B_DANRE Ras-related protein Rap-1b OS=Danio rerio GN=rap1b PE=2 SV=1 58 223 2.0E-12
sp|Q9YH37|RAP1B_CYPCA Ras-related protein Rap-1b OS=Cyprinus carpio GN=rap1b PE=2 SV=1 58 223 2.0E-12
sp|Q5R7L7|RAB5C_PONAB Ras-related protein Rab-5C OS=Pongo abelii GN=RAB5C PE=2 SV=1 58 249 2.0E-12
sp|P51148|RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 58 249 2.0E-12
sp|P11233|RALA_HUMAN Ras-related protein Ral-A OS=Homo sapiens GN=RALA PE=1 SV=1 58 223 2.0E-12
sp|Q54KM9|RB11B_DICDI Ras-related protein Rab-11B OS=Dictyostelium discoideum GN=rab11B PE=2 SV=1 58 225 2.0E-12
sp|P62824|RAB3C_RAT Ras-related protein Rab-3C OS=Rattus norvegicus GN=Rab3c PE=1 SV=1 55 255 2.0E-12
sp|P62823|RAB3C_MOUSE Ras-related protein Rab-3C OS=Mus musculus GN=Rab3c PE=1 SV=1 55 255 2.0E-12
sp|Q5R4B8|RALB_PONAB Ras-related protein Ral-B OS=Pongo abelii GN=RALB PE=2 SV=1 58 223 2.0E-12
sp|P11234|RALB_HUMAN Ras-related protein Ral-B OS=Homo sapiens GN=RALB PE=1 SV=1 58 223 2.0E-12
sp|P36862|YPTV3_VOLCA GTP-binding protein yptV3 OS=Volvox carteri GN=YPTV3 PE=3 SV=1 55 231 2.0E-12
sp|Q8MXS1|RAB18_CAEEL Ras-related protein Rab-18 OS=Caenorhabditis elegans GN=rab-18 PE=3 SV=1 52 227 2.0E-12
sp|Q9JKM7|RAB37_MOUSE Ras-related protein Rab-37 OS=Mus musculus GN=Rab37 PE=1 SV=2 52 223 2.0E-12
sp|P36860|RALB_RAT Ras-related protein Ral-B OS=Rattus norvegicus GN=Ralb PE=2 SV=1 58 223 2.0E-12
sp|Q4R379|RALB_MACFA Ras-related protein Ral-B OS=Macaca fascicularis GN=RALB PE=2 SV=1 58 223 2.0E-12
sp|Q550Q4|RHEB_DICDI GTP-binding protein Rheb homolog OS=Dictyostelium discoideum GN=rheb PE=3 SV=1 52 227 2.0E-12
sp|P36864|YPTV5_VOLCA GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1 58 239 3.0E-12
sp|Q61820|RANT_MOUSE GTP-binding nuclear protein Ran, testis-specific isoform OS=Mus musculus GN=Rasl2-9 PE=2 SV=1 53 175 3.0E-12
sp|Q640R7|RAP1B_XENTR Ras-related protein Rap-1b OS=Xenopus tropicalis GN=rap1b PE=2 SV=1 58 223 3.0E-12
sp|Q7ZXH7|RAP1B_XENLA Ras-related protein Rap-1b OS=Xenopus laevis GN=rap1b PE=2 SV=1 58 223 3.0E-12
sp|P31582|RAF2A_ARATH Ras-related protein RABF2a OS=Arabidopsis thaliana GN=RABF2A PE=1 SV=1 56 223 3.0E-12
sp|Q8K586|RANT_RAT GTP-binding nuclear protein Ran, testis-specific isoform OS=Rattus norvegicus GN=Rasl2-9 PE=2 SV=1 53 175 3.0E-12
sp|Q5R9Y4|RAB7A_PONAB Ras-related protein Rab-7a OS=Pongo abelii GN=RAB7A PE=2 SV=1 58 224 3.0E-12
sp|Q7RVL0|GSP1_NEUCR GTP-binding nuclear protein GSP1/Ran OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ran PE=2 SV=1 53 178 3.0E-12
sp|Q58DS9|RAB5C_BOVIN Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C PE=2 SV=1 58 249 4.0E-12
sp|P09527|RAB7A_RAT Ras-related protein Rab-7a OS=Rattus norvegicus GN=Rab7a PE=1 SV=2 58 224 4.0E-12
sp|P38146|YPT10_YEAST GTP-binding protein YPT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT10 PE=1 SV=2 58 174 4.0E-12
sp|P51150|RAB7A_MOUSE Ras-related protein Rab-7a OS=Mus musculus GN=Rab7a PE=1 SV=2 58 224 4.0E-12
sp|P51149|RAB7A_HUMAN Ras-related protein Rab-7a OS=Homo sapiens GN=RAB7A PE=1 SV=1 58 224 4.0E-12
sp|P18067|RAB7A_CANLF Ras-related protein Rab-7a OS=Canis lupus familiaris GN=RAB7A PE=2 SV=1 58 224 4.0E-12
sp|Q9JIW9|RALB_MOUSE Ras-related protein Ral-B OS=Mus musculus GN=Ralb PE=1 SV=1 58 223 4.0E-12
sp|Q40191|RB11A_LOTJA Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1 36 269 4.0E-12
sp|Q948K8|RAG3A_ARATH Ras-related protein RABG3a OS=Arabidopsis thaliana GN=RABG3A PE=2 SV=1 58 236 4.0E-12
sp|Q3T0F5|RAB7A_BOVIN Ras-related protein Rab-7a OS=Bos taurus GN=RAB7A PE=2 SV=1 58 227 4.0E-12
sp|Q9C2L8|RAB7_NEUCR Probable Ras-related protein Rab7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.300 PE=3 SV=1 58 224 4.0E-12
sp|Q5ZIT5|RAB10_CHICK Ras-related protein Rab-10 OS=Gallus gallus GN=RAB10 PE=2 SV=1 58 223 4.0E-12
sp|O94363|RHB1_SCHPO GTP-binding protein rhb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhb1 PE=3 SV=1 52 227 4.0E-12
sp|Q41640|RAB7_VIGAC Ras-related protein Rab7 OS=Vigna aconitifolia PE=2 SV=1 58 234 5.0E-12
sp|P36409|RAB2A_DICDI Ras-related protein Rab-2A OS=Dictyostelium discoideum GN=rab2A PE=2 SV=2 58 223 5.0E-12
sp|Q8MYF2|RABJ_DICDI Ras-related protein RabJ OS=Dictyostelium discoideum GN=rabJ PE=3 SV=1 58 223 5.0E-12
sp|P10948|RAB3B_BOVIN Ras-related protein Rab-3B OS=Bos taurus GN=RAB3B PE=2 SV=1 37 227 5.0E-12
sp|P20337|RAB3B_HUMAN Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3B PE=1 SV=2 55 227 5.0E-12
sp|P35288|RAB23_MOUSE Ras-related protein Rab-23 OS=Mus musculus GN=Rab23 PE=1 SV=2 58 225 6.0E-12
sp|Q7Z444|RASE_HUMAN GTPase ERas OS=Homo sapiens GN=ERAS PE=2 SV=1 51 240 7.0E-12
sp|P22127|RAB10_DIPOM Ras-related protein Rab-10 OS=Diplobatis ommata PE=2 SV=1 58 223 7.0E-12
sp|P18262|RAS_ARTSA Ras-like protein (Fragment) OS=Artemia salina PE=3 SV=1 65 223 7.0E-12
sp|P35283|RAB12_MOUSE Ras-related protein Rab-12 OS=Mus musculus GN=Rab12 PE=1 SV=3 28 223 7.0E-12
sp|Q9CZT8|RAB3B_MOUSE Ras-related protein Rab-3B OS=Mus musculus GN=Rab3b PE=1 SV=1 55 227 8.0E-12
sp|Q5KTJ7|RAB3B_MESAU Ras-related protein Rab-3B OS=Mesocricetus auratus GN=RAB3B PE=2 SV=1 55 227 8.0E-12
sp|O95716|RAB3D_HUMAN Ras-related protein Rab-3D OS=Homo sapiens GN=RAB3D PE=1 SV=1 55 230 8.0E-12
sp|Q921J2|RHEB_MOUSE GTP-binding protein Rheb OS=Mus musculus GN=Rheb PE=1 SV=1 56 228 9.0E-12
sp|Q98932|RAB5C_CHICK Ras-related protein Rab-5C OS=Gallus gallus GN=RAB5C PE=1 SV=1 58 256 9.0E-12
sp|Q63941|RAB3B_RAT Ras-related protein Rab-3B OS=Rattus norvegicus GN=Rab3b PE=1 SV=2 55 227 9.0E-12
sp|Q56JV3|RHEB_BOVIN GTP-binding protein Rheb OS=Bos taurus GN=RHEB PE=2 SV=1 56 228 1.0E-11
sp|Q1PEX3|RAA1H_ARATH Ras-related protein RABA1h OS=Arabidopsis thaliana GN=RABA1H PE=2 SV=1 55 259 1.0E-11
sp|O18334|RAB6_DROME Ras-related protein Rab6 OS=Drosophila melanogaster GN=Rab6 PE=1 SV=1 53 226 1.0E-11
sp|P41917|RAN2_ARATH GTP-binding nuclear protein Ran-2 OS=Arabidopsis thaliana GN=RAN2 PE=1 SV=3 48 178 1.0E-11
sp|Q5R5U1|RAB10_PONAB Ras-related protein Rab-10 OS=Pongo abelii GN=RAB10 PE=2 SV=1 58 223 1.0E-11
sp|P61027|RAB10_MOUSE Ras-related protein Rab-10 OS=Mus musculus GN=Rab10 PE=1 SV=1 58 223 1.0E-11
sp|P61026|RAB10_HUMAN Ras-related protein Rab-10 OS=Homo sapiens GN=RAB10 PE=1 SV=1 58 223 1.0E-11
sp|P92963|RAB1C_ARATH Ras-related protein RABB1c OS=Arabidopsis thaliana GN=RABB1C PE=1 SV=1 55 223 1.0E-11
sp|P35284|RAB12_RAT Ras-related protein Rab-12 OS=Rattus norvegicus GN=Rab12 PE=1 SV=2 30 223 1.0E-11
sp|Q9YH09|RALBA_XENLA Ras-related protein ralB-A OS=Xenopus laevis GN=ralb-a PE=1 SV=1 58 223 1.0E-11
sp|Q15382|RHEB_HUMAN GTP-binding protein Rheb OS=Homo sapiens GN=RHEB PE=1 SV=1 56 228 1.0E-11
sp|Q62639|RHEB_RAT GTP-binding protein Rheb OS=Rattus norvegicus GN=Rheb PE=1 SV=1 56 228 1.0E-11
sp|Q9C820|RAG3D_ARATH Ras-related protein RABG3d OS=Arabidopsis thaliana GN=RABG3D PE=2 SV=1 58 224 1.0E-11
sp|Q55CC0|RASW_DICDI Ras-like protein rasW OS=Dictyostelium discoideum GN=rasW PE=3 SV=1 59 269 1.0E-11
sp|P61271|RAB5A_MACFA Ras-related protein Rab-5A OS=Macaca fascicularis GN=RAB5A PE=2 SV=1 58 223 1.0E-11
sp|P20339|RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 58 223 1.0E-11
sp|P18066|RAB5A_CANLF Ras-related protein Rab-5A OS=Canis lupus familiaris GN=RAB5A PE=1 SV=1 58 223 1.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0003924 GTPase activity Yes
GO:0005525 GTP binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0016787 hydrolase activity No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0016462 pyrophosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0032561 guanyl ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Lysosome/Vacuole 0.4481 0.2117 0.0564 0.6393 0.2126 0.0207 0.3349 0.608 0.3744 0.0691

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3420
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3517
Ophiocordyceps australis map64 (Brazil) OphauB2|6539
Ophiocordyceps camponoti-floridani Ophcf2|06637
Ophiocordyceps camponoti-rufipedis Ophun1|3899
Ophiocordyceps kimflemingae Ophio5|3732
Ophiocordyceps subramaniannii Hirsu2|6450 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6450
MASQSYRNSYYAPASYDQVRREQRTRSSEGTVSTTMSSSSGRASSVTQITEAPTYSKKIVVVGDGGCGKTCLLIS
YSQGHFPEKYVPTVFENYIAFPTHPPTGKTVELALWDTAGQEEYDRLRPLSYPETDLIFVCFAIDCPNSLDNVLD
KWYPEVLHFCPYTPLILIGLKSDLRYKKSCIDMLKTQGLTPVTTEQGMAVADKMGAHYMECSSKEMRGVDEIFEH
AILIVVANDRRNQEAGGSPSSASGGQRSSMPGVKVPKRKKRRCQFL*
Coding >Hirsu2|6450
ATGGCCTCACAATCGTATCGCAACTCCTACTATGCGCCCGCGAGCTATGACCAGGTCCGGCGCGAGCAGCGCACG
CGCTCGAGCGAGGGCACCGTCAGCACCACCATGAGTTCCTCGTCGGGGCGCGCATCGTCGGTGACGCAAATAACG
GAGGCGCCCACCTACTCCAAGAAGATCGTCGTCGTCGGCGACGGCGGCTGCGGTAAGACGTGCCTGCTCATCAGC
TACAGCCAGGGCCATTTCCCCGAGAAATACGTGCCTACCGTCTTCGAGAACTACATCGCCTTTCCCACGCACCCG
CCCACCGGTAAGACGGTCGAGCTCGCTCTATGGGACACGGCTGGCCAAGAAGAGTACGACCGGCTTCGGCCGCTG
TCGTACCCAGAGACGGACCTCATATTCGTCTGCTTCGCCATCGACTGCCCCAACTCGCTCGACAATGTTCTGGAC
AAGTGGTACCCTGAAGTCTTGCATTTCTGCCCCTACACCCCCCTCATCCTCATCGGCCTCAAGTCGGACCTGCGG
TACAAGAAGAGCTGCATCGACATGCTCAAGACGCAAGGGCTGACGCCCGTCACCACCGAGCAGGGCATGGCCGTG
GCCGACAAGATGGGCGCCCACTACATGGAGTGCAGCAGCAAGGAGATGCGCGGCGTCGACGAGATCTTCGAGCAC
GCCATCCTGATCGTCGTCGCCAACGACCGGAGAAACCAGGAAGCCGGCGGCTCGCCCTCGTCGGCCTCTGGCGGC
CAGCGATCGTCGATGCCCGGGGTCAAGGTTCCGAAGCGGAAGAAGAGAAGGTGTCAGTTCCTCTGA
Transcript >Hirsu2|6450
ATGGCCTCACAATCGTATCGCAACTCCTACTATGCGCCCGCGAGCTATGACCAGGTCCGGCGCGAGCAGCGCACG
CGCTCGAGCGAGGGCACCGTCAGCACCACCATGAGTTCCTCGTCGGGGCGCGCATCGTCGGTGACGCAAATAACG
GAGGCGCCCACCTACTCCAAGAAGATCGTCGTCGTCGGCGACGGCGGCTGCGGTAAGACGTGCCTGCTCATCAGC
TACAGCCAGGGCCATTTCCCCGAGAAATACGTGCCTACCGTCTTCGAGAACTACATCGCCTTTCCCACGCACCCG
CCCACCGGTAAGACGGTCGAGCTCGCTCTATGGGACACGGCTGGCCAAGAAGAGTACGACCGGCTTCGGCCGCTG
TCGTACCCAGAGACGGACCTCATATTCGTCTGCTTCGCCATCGACTGCCCCAACTCGCTCGACAATGTTCTGGAC
AAGTGGTACCCTGAAGTCTTGCATTTCTGCCCCTACACCCCCCTCATCCTCATCGGCCTCAAGTCGGACCTGCGG
TACAAGAAGAGCTGCATCGACATGCTCAAGACGCAAGGGCTGACGCCCGTCACCACCGAGCAGGGCATGGCCGTG
GCCGACAAGATGGGCGCCCACTACATGGAGTGCAGCAGCAAGGAGATGCGCGGCGTCGACGAGATCTTCGAGCAC
GCCATCCTGATCGTCGTCGCCAACGACCGGAGAAACCAGGAAGCCGGCGGCTCGCCCTCGTCGGCCTCTGGCGGC
CAGCGATCGTCGATGCCCGGGGTCAAGGTTCCGAAGCGGAAGAAGAGAAGGTGTCAGTTCCTCTGA
Gene >Hirsu2|6450
ATGGCCTCACAATCGTATCGCAACTCCTACTATGCGCCCGCGAGCTATGACCAGGTCCGGCGCGAGCAGCGCACG
CGCTCGAGCGAGGGCACCGTCAGCACCACCATGAGTTCCTCGTCGGGGCGCGCATCGTCGGTGACGCAAATAACG
GAGGCGCCCACCTACTCCAAGAAGATCGTCGTCGTCGGCGACGGCGGCTGCGGTAAGACGTGCCTGCTCATCAGC
TACAGCCAGGGCCATTTCCCCGAGGTGAGTATTATCATCATCAACCACCGCCCTCCCTTCCATTCTCCATCGTCG
CATCTCGTCTCCATGGCTGACGCCCTGCGCGGGGTCTTGAGCAGAAATACGTGCCTACCGTCTTCGAGAACTACA
TCGCCTTTCCCACGCACCCGCCCACCGGTAAGACGGTCGAGCTCGCTCTATGGGACACGGCTGGCCAAGAAGAGT
ACGACCGGCTTCGGCCGCTGTCGTACCCAGAGACGGACCTCATATTCGTCTGCTTCGCCATCGACTGCCCCAACT
CGCTCGACAATGTTCTGGACAAGGTACGGTGACCCCTTTCCTCCCGGCCTTGGTTTCCTGCGATGCTGACGAGCC
GAAAGTGGTACCCTGAAGTCTTGCATTTCTGCCCCTACACCCCCCTCATCCTCATCGGCCTCAAGTCGGACCTGC
GGTACAAGAAGAGCTGCATCGACATGCTCAAGACGCAAGGGCTGACGCCCGTCACCACCGAGCAGGGCATGGCCG
TGGCCGACAAGATGGGCGCCCACTACATGGAGTGCAGCAGCAAGGAGATGCGCGGCGTCGACGAGATCTTCGAGC
ACGCCATCCTGATCGTCGTCGCCAACGACCGGAGAAACCAGGAAGCCGGCGGCTCGCCCTCGTCGGCCTCTGGCG
GCCAGCGATCGTCGATGCCCGGGGTCAAGGTTCCGAAGCGGAAGAAGAGAAGGTGTCAGTTCCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail