Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6448
Gene name
LocationContig_331:5178..6467
Strand-
Gene length (bp)1289
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 6.8E-18 93 247
PF13649 Methyltransf_25 Methyltransferase domain 8.0E-08 99 187
PF13847 Methyltransf_31 Methyltransferase domain 2.8E-07 98 195
PF08241 Methyltransf_11 Methyltransferase domain 2.7E-05 100 190

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q72HI4|MENG_THET2 Demethylmenaquinone methyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=menG PE=3 SV=1 90 194 2.0E-08
sp|Q9RRT0|MENG_DEIRA Demethylmenaquinone methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=menG PE=3 SV=1 95 194 6.0E-07

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6448
MAQSNKTFHCHGRVLELDPAEGADYERPSATRSRSNGAAAPRGGDRDGGDGRDDDSRDGSYFLPTDSAEQDRLDE
QHKLCLMLLDGKLGLAPVKAPRRVLDVATGTGIWAIQYAEQQPQAEVVGADLCVFQHESPAANCSFVRLDVEKDA
WGLDHGFDYIHFRYVLSCFDDTRAVIGTAFDHLSPGGYVEFHDFVFSIVDLDGSFKGTALERWQAAVSRGAASVG
RDLNKAVLYPGWCRDAGFVDVTETLFPLPFGTWVRGAAMKRLGEAAVRNIRALIGGSLRSFLELAGLSKSEMEEL
IDEAMEDTRDPNIHYAGTV*
Coding >Hirsu2|6448
ATGGCGCAGTCGAATAAGACGTTTCACTGCCACGGGCGTGTCCTGGAGCTCGACCCGGCCGAGGGGGCCGACTAC
GAGAGGCCGAGCGCAACGAGGAGTCGCAGCAACGGGGCCGCGGCGCCGAGGGGCGGAGACCGCGACGGCGGCGAC
GGCCGGGACGACGACAGCCGTGATGGATCGTACTTCCTGCCGACTGATTCGGCGGAACAAGACCGTCTGGATGAG
CAGCACAAGCTGTGTCTCATGCTGCTGGACGGCAAGCTGGGTCTGGCGCCCGTCAAGGCACCTCGGCGTGTCCTC
GACGTCGCGACAGGGACGGGCATCTGGGCCATCCAGTACGCGGAGCAGCAGCCGCAGGCCGAGGTCGTCGGCGCG
GACCTGTGCGTCTTCCAGCACGAGTCGCCGGCGGCCAACTGCTCCTTCGTCCGGCTGGATGTCGAGAAGGACGCG
TGGGGCTTGGATCACGGCTTCGACTACATCCACTTCCGCTACGTGCTCAGCTGCTTCGACGACACGCGGGCCGTG
ATCGGCACGGCCTTTGACCACCTCAGCCCGGGCGGCTACGTCGAGTTCCACGACTTCGTCTTCTCCATCGTCGAC
CTCGACGGCTCCTTCAAGGGCACCGCCCTCGAGCGCTGGCAGGCCGCCGTCAGCAGGGGCGCCGCCAGCGTCGGC
CGCGACCTCAACAAGGCCGTCCTGTACCCCGGCTGGTGCCGCGACGCCGGCTTCGTCGACGTGACCGAGACGCTG
TTCCCGCTGCCCTTCGGCACCTGGGTCAGGGGGGCGGCCATGAAGAGGTTGGGTGAAGCGGCGGTGCGCAACATC
CGGGCGCTGATTGGCGGCTCGCTCAGGAGCTTCCTCGAGCTGGCCGGCCTGTCCAAGAGCGAGATGGAGGAGCTG
ATCGACGAGGCCATGGAGGACACGCGAGACCCGAATATTCATTACGCCGGCACCGTGTGA
Transcript >Hirsu2|6448
ATGGCGCAGTCGAATAAGACGTTTCACTGCCACGGGCGTGTCCTGGAGCTCGACCCGGCCGAGGGGGCCGACTAC
GAGAGGCCGAGCGCAACGAGGAGTCGCAGCAACGGGGCCGCGGCGCCGAGGGGCGGAGACCGCGACGGCGGCGAC
GGCCGGGACGACGACAGCCGTGATGGATCGTACTTCCTGCCGACTGATTCGGCGGAACAAGACCGTCTGGATGAG
CAGCACAAGCTGTGTCTCATGCTGCTGGACGGCAAGCTGGGTCTGGCGCCCGTCAAGGCACCTCGGCGTGTCCTC
GACGTCGCGACAGGGACGGGCATCTGGGCCATCCAGTACGCGGAGCAGCAGCCGCAGGCCGAGGTCGTCGGCGCG
GACCTGTGCGTCTTCCAGCACGAGTCGCCGGCGGCCAACTGCTCCTTCGTCCGGCTGGATGTCGAGAAGGACGCG
TGGGGCTTGGATCACGGCTTCGACTACATCCACTTCCGCTACGTGCTCAGCTGCTTCGACGACACGCGGGCCGTG
ATCGGCACGGCCTTTGACCACCTCAGCCCGGGCGGCTACGTCGAGTTCCACGACTTCGTCTTCTCCATCGTCGAC
CTCGACGGCTCCTTCAAGGGCACCGCCCTCGAGCGCTGGCAGGCCGCCGTCAGCAGGGGCGCCGCCAGCGTCGGC
CGCGACCTCAACAAGGCCGTCCTGTACCCCGGCTGGTGCCGCGACGCCGGCTTCGTCGACGTGACCGAGACGCTG
TTCCCGCTGCCCTTCGGCACCTGGGTCAGGGGGGCGGCCATGAAGAGGTTGGGTGAAGCGGCGGTGCGCAACATC
CGGGCGCTGATTGGCGGCTCGCTCAGGAGCTTCCTCGAGCTGGCCGGCCTGTCCAAGAGCGAGATGGAGGAGCTG
ATCGACGAGGCCATGGAGGACACGCGAGACCCGAATATTCATTACGCCGGCACCGTGTGA
Gene >Hirsu2|6448
ATGGCGCAGTCGAATAAGACGTTTCACTGCCACGGGCGTGTCCTGGAGCTCGACCCGGCCGAGGGGGCCGACTAC
GAGAGGCCGAGCGCAACGAGGTGAGCAAGGCGAAGTTGGCGCCGGAGCGGAAGAAAGGGGAGGGGTCCGGTGTTG
ACGCGTTGGCCTCAGGAGTCGCAGCAACGGGGCCGCGGCGCCGAGGGGCGGAGACCGCGACGGCGGCGACGGCCG
GGACGACGACAGCCGTGATGGATGTGAGTTGCCGTGCCGCTGCTTCGACGAGCGCCTGCGCTGACGTGTTCCCTT
CGTTCCGGGGGGCAGCGTACTTCCTGCCGACTGATTCGGTGAGTCCGGGTTCTCGGTCCGTCGACCGCGACACAT
CCGGCTGACTGCCGTCTCCCAAGGCGGAACAAGACCGTCTGGGTGAGTTCTTCTGTTGCTTCTTCTCCTCACCTT
GGCCGCCGTCTGACCGATCGACGGACACAACAGATGAGCAGCACAAGCTGTGTCTCATGCTGCTGGACGGCAAGC
TGGGTCTGGCGCCCGTCAAGGCACCTCGGCGTGTCCTCGACGTCGCGACAGGGACGGGCATCTGGGCCATCCAGT
ACGGTACGTCGTGCGAACGAGTCCCGCCCCCCTTGCGTTCCTTCGTCGTCGCCGCTGAACACGCGCCAGCGGAGC
AGCAGCCGCAGGCCGAGGTCGTCGGCGCGGACCTGTGCGTCTTCCAGCACGAGTCGCCGGCGGCCAACTGCTCCT
TCGTCCGGCTGGATGTCGAGAAGGACGCGTGGGGCTTGGATCACGGCTTCGACTACATCCACTTCCGCTACGTGC
TCAGCTGCTTCGACGACACGCGGGCCGTGATCGGCACGGCCTTTGACCACCTCAGCCCGGGCGGCTACGTCGAGT
TCCACGACTTCGTCTTCTCCATCGTCGACCTCGACGGCTCCTTCAAGGGCACCGCCCTCGAGCGCTGGCAGGCCG
CCGTCAGCAGGGGCGCCGCCAGCGTCGGCCGCGACCTCAACAAGGCCGTCCTGTACCCCGGCTGGTGCCGCGACG
CCGGCTTCGTCGACGTGACCGAGACGCTGTTCCCGCTGCCCTTCGGCACCTGGGTCAGGGGGGCGGCCATGAAGA
GGTTGGGTGAAGCGGCGGTGCGCAACATCCGGGCGCTGATTGGCGGCTCGCTCAGGAGCTTCCTCGAGCTGGCCG
GCCTGTCCAAGAGCGAGATGGAGGAGCTGATCGACGAGGCCATGGAGGACACGCGAGACCCGAATATTCATTACG
CCGGCACCGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail