Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6447
Gene name
LocationContig_331:4062..4926
Strand+
Gene length (bp)864
Transcript length (bp)714
Coding sequence length (bp)714
Protein length (aa) 238

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.1E-15 11 207
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.1E-15 18 208
PF08659 KR KR domain 4.1E-09 11 112

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O00058|MTDH_UROFA Probable NADP-dependent mannitol dehydrogenase OS=Uromyces fabae GN=PIG8 PE=2 SV=1 7 219 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6447
MAGRKCDYCLVVIGSGPGIGVHVGALFASRRYSRLALIARSEPRLAEDRAAIEAAAPGVSVKTYAADVTDLARLR
AVLDQIGRDLGTVECLFFNAAQVRPSKLLEADEDDMVYDFKIACSSLHVTAKWAVPQLVQLSRSDPDAKPSLLIT
SSLLPQQPDPDCFFALSVVKAAQRNMAESMAKVYGPQGVHVGLIVVGGVVDPSNRTLNPKHIAERTWDLFNQPWD
ARTFEVEILEDS*
Coding >Hirsu2|6447
ATGGCAGGTCGAAAGTGCGACTACTGCCTCGTCGTCATCGGCTCCGGCCCAGGCATCGGCGTCCACGTCGGCGCT
CTCTTCGCCTCCAGGCGCTACTCCAGGCTCGCCCTCATCGCCCGCAGCGAGCCGCGTCTCGCCGAAGACCGCGCC
GCCATCGAGGCCGCAGCCCCGGGCGTCTCGGTCAAGACGTATGCGGCCGACGTGACCGATCTGGCGCGGTTGCGG
GCCGTCCTGGACCAGATCGGACGGGATCTGGGCACCGTCGAGTGTCTCTTCTTCAACGCCGCTCAGGTGCGGCCG
TCGAAGCTTCTCGAGGCTGACGAGGACGACATGGTCTACGACTTCAAGATCGCGTGCAGCAGTCTTCATGTTACG
GCGAAGTGGGCTGTGCCGCAGCTTGTCCAGCTCTCGCGATCCGATCCGGACGCGAAGCCGTCGCTGCTCATCACC
AGCTCTCTCCTACCGCAGCAGCCAGACCCGGACTGTTTTTTCGCCCTCTCCGTGGTGAAGGCGGCACAGAGGAAC
ATGGCCGAGTCCATGGCCAAGGTCTACGGCCCGCAGGGCGTCCACGTCGGTCTCATAGTCGTGGGGGGGGTTGTG
GACCCTTCCAACAGGACGTTGAACCCCAAGCACATTGCTGAGCGGACGTGGGACCTGTTCAATCAGCCGTGGGAC
GCCAGGACGTTTGAGGTAGAGATCCTGGAAGATTCGTAG
Transcript >Hirsu2|6447
ATGGCAGGTCGAAAGTGCGACTACTGCCTCGTCGTCATCGGCTCCGGCCCAGGCATCGGCGTCCACGTCGGCGCT
CTCTTCGCCTCCAGGCGCTACTCCAGGCTCGCCCTCATCGCCCGCAGCGAGCCGCGTCTCGCCGAAGACCGCGCC
GCCATCGAGGCCGCAGCCCCGGGCGTCTCGGTCAAGACGTATGCGGCCGACGTGACCGATCTGGCGCGGTTGCGG
GCCGTCCTGGACCAGATCGGACGGGATCTGGGCACCGTCGAGTGTCTCTTCTTCAACGCCGCTCAGGTGCGGCCG
TCGAAGCTTCTCGAGGCTGACGAGGACGACATGGTCTACGACTTCAAGATCGCGTGCAGCAGTCTTCATGTTACG
GCGAAGTGGGCTGTGCCGCAGCTTGTCCAGCTCTCGCGATCCGATCCGGACGCGAAGCCGTCGCTGCTCATCACC
AGCTCTCTCCTACCGCAGCAGCCAGACCCGGACTGTTTTTTCGCCCTCTCCGTGGTGAAGGCGGCACAGAGGAAC
ATGGCCGAGTCCATGGCCAAGGTCTACGGCCCGCAGGGCGTCCACGTCGGTCTCATAGTCGTGGGGGGGGTTGTG
GACCCTTCCAACAGGACGTTGAACCCCAAGCACATTGCTGAGCGGACGTGGGACCTGTTCAATCAGCCGTGGGAC
GCCAGGACGTTTGAGGTAGAGATCCTGGAAGATTCGTAG
Gene >Hirsu2|6447
ATGGCAGGTCGAAAGTGCGACTACTGCCTCGTCGTCATCGGCTCCGGCCCAGGCATCGGCGTCCACGTCGGCGCT
CTCTTCGCCTCCAGGCGCTACTCCAGGCTCGCCCTCATCGCCCGCAGCGAGCCGCGTCTCGCCGAAGACCGCGCC
GCCATCGAGGCCGCAGCCCCGGGCGTCTCGGTCAAGACGTATGCGGCCGACGTGACCGATCTGGCGCGGTTGCGG
GCCGTCCTGGACCAGATCGGACGGGATCTGGGCACCGTCGAGTGTCTCTTCTTCAACGCCGCTCAGGTGCGGCCG
TCGAAGCTTCTCGAGGCTGACGAGGACGACATGGTCTACGACTTCAAGGTGCGTCGCATCTTCATTCTTCGTGAC
CTTCTGGGGGCCCGCAGAGTCCTGGGCGGTGCGGCGGCGCCCTAGACACACACGGTCGCGCTCCGCCCGTCAGAC
ACCACGACCGGCCAACTGACATCGTCACGAACGGCGAGGGGGGAGCAGATCGCGTGCAGCAGTCTTCATGTTACG
GCGAAGTGGGCTGTGCCGCAGCTTGTCCAGCTCTCGCGATCCGATCCGGACGCGAAGCCGTCGCTGCTCATCACC
AGCTCTCTCCTACCGCAGCAGCCAGACCCGGACTGTTTTTTCGCCCTCTCCGTGGTGAAGGCGGCACAGAGGAAC
ATGGCCGAGTCCATGGCCAAGGTCTACGGCCCGCAGGGCGTCCACGTCGGTCTCATAGTCGTGGGGGGGGTTGTG
GACCCTTCCAACAGGACGTTGAACCCCAAGCACATTGCTGAGCGGACGTGGGACCTGTTCAATCAGCCGTGGGAC
GCCAGGACGTTTGAGGTAGAGATCCTGGAAGATTCGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail