Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6438
Gene name
LocationContig_330:20295..22563
Strand+
Gene length (bp)2268
Transcript length (bp)1839
Coding sequence length (bp)1839
Protein length (aa) 613

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain 8.7E-108 231 456
PF16886 ATP-synt_ab_Xtn ATPsynthase alpha/beta subunit N-term extension 5.7E-47 101 222
PF02874 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barrel domain 1.8E-14 23 85

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11592|VATA_NEUCR V-type proton ATPase catalytic subunit A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-1 PE=3 SV=1 1 612 0.0E+00
sp|Q9UVJ8|VATA_ASHGO V-type proton ATPase catalytic subunit A OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VMA1 PE=3 SV=3 14 611 0.0E+00
sp|Q5AJB1|VATA_CANAL V-type proton ATPase catalytic subunit A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TFP1 PE=1 SV=1 36 607 0.0E+00
sp|P31406|VATA_SCHPO V-type proton ATPase catalytic subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma1 PE=3 SV=1 12 611 0.0E+00
sp|Q9XW92|VATA_CAEEL V-type proton ATPase catalytic subunit A OS=Caenorhabditis elegans GN=vha-13 PE=1 SV=3 18 611 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11592|VATA_NEUCR V-type proton ATPase catalytic subunit A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-1 PE=3 SV=1 1 612 0.0E+00
sp|Q9UVJ8|VATA_ASHGO V-type proton ATPase catalytic subunit A OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VMA1 PE=3 SV=3 14 611 0.0E+00
sp|Q5AJB1|VATA_CANAL V-type proton ATPase catalytic subunit A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TFP1 PE=1 SV=1 36 607 0.0E+00
sp|P31406|VATA_SCHPO V-type proton ATPase catalytic subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma1 PE=3 SV=1 12 611 0.0E+00
sp|Q9XW92|VATA_CAEEL V-type proton ATPase catalytic subunit A OS=Caenorhabditis elegans GN=vha-13 PE=1 SV=3 18 611 0.0E+00
sp|Q61VZ4|VATA_CAEBR V-type proton ATPase catalytic subunit A OS=Caenorhabditis briggsae GN=vha-13 PE=3 SV=1 18 611 0.0E+00
sp|Q5R5H2|VATA_PONAB V-type proton ATPase catalytic subunit A OS=Pongo abelii GN=ATP6V1A PE=2 SV=1 18 611 0.0E+00
sp|P38606|VATA_HUMAN V-type proton ATPase catalytic subunit A OS=Homo sapiens GN=ATP6V1A PE=1 SV=2 18 611 0.0E+00
sp|P31400|VATA_MANSE V-type proton ATPase catalytic subunit A OS=Manduca sexta GN=VHAA PE=2 SV=1 1 611 0.0E+00
sp|Q90647|VATA_CHICK V-type proton ATPase catalytic subunit A OS=Gallus gallus GN=ATP6V1A PE=2 SV=1 21 611 0.0E+00
sp|P31404|VATA_BOVIN V-type proton ATPase catalytic subunit A OS=Bos taurus GN=ATP6V1A PE=2 SV=2 18 611 0.0E+00
sp|P50516|VATA_MOUSE V-type proton ATPase catalytic subunit A OS=Mus musculus GN=Atp6v1a PE=1 SV=2 18 611 0.0E+00
sp|Q27331|VATA2_DROME V-type proton ATPase catalytic subunit A isoform 2 OS=Drosophila melanogaster GN=Vha68-2 PE=1 SV=2 18 611 0.0E+00
sp|Q29048|VATA_PIG V-type proton ATPase catalytic subunit A OS=Sus scrofa GN=ATP6V1A PE=2 SV=2 18 611 0.0E+00
sp|Q5TTG1|VATA_ANOGA V-type proton ATPase catalytic subunit A OS=Anopheles gambiae GN=Vha68-2 PE=3 SV=1 18 611 0.0E+00
sp|Q2TJ56|VATA_AEDAL V-type proton ATPase catalytic subunit A OS=Aedes albopictus GN=VhaA PE=2 SV=1 18 611 0.0E+00
sp|O16109|VATA_AEDAE V-type proton ATPase catalytic subunit A OS=Aedes aegypti GN=VhaA PE=2 SV=2 18 611 0.0E+00
sp|P48602|VATA1_DROME V-type proton ATPase catalytic subunit A isoform 1 OS=Drosophila melanogaster GN=Vha68-1 PE=2 SV=2 18 611 0.0E+00
sp|O23654|VATA_ARATH V-type proton ATPase catalytic subunit A OS=Arabidopsis thaliana GN=VHA-A PE=1 SV=1 14 612 0.0E+00
sp|Q39291|VATA_BRANA V-type proton ATPase catalytic subunit A OS=Brassica napus PE=2 SV=1 14 612 0.0E+00
sp|Q9SM09|VATA_CITUN V-type proton ATPase catalytic subunit A OS=Citrus unshiu PE=2 SV=1 18 612 0.0E+00
sp|P09469|VATA_DAUCA V-type proton ATPase catalytic subunit A OS=Daucus carota PE=2 SV=1 18 612 0.0E+00
sp|P31405|VATA_GOSHI V-type proton ATPase catalytic subunit A OS=Gossypium hirsutum GN=CVA69.24 PE=2 SV=1 18 612 0.0E+00
sp|P13548|VATA_VIGRR V-type proton ATPase catalytic subunit A OS=Vigna radiata var. radiata PE=1 SV=3 18 612 0.0E+00
sp|P54647|VATA_DICDI V-type proton ATPase catalytic subunit A OS=Dictyostelium discoideum GN=vatA PE=1 SV=2 11 611 0.0E+00
sp|Q38677|VATA2_ACEAT V-type proton ATPase catalytic subunit A isoform 2 OS=Acetabularia acetabulum PE=2 SV=1 20 612 0.0E+00
sp|Q38676|VATA1_ACEAT V-type proton ATPase catalytic subunit A isoform 1 OS=Acetabularia acetabulum PE=2 SV=1 20 612 0.0E+00
sp|P48414|VATA_CYACA V-type proton ATPase catalytic subunit A OS=Cyanidium caldarium PE=3 SV=1 16 587 0.0E+00
sp|Q39442|VATA_BETVU V-type proton ATPase catalytic subunit A OS=Beta vulgaris PE=2 SV=1 18 612 0.0E+00
sp|Q26975|VATA_TRYCO V-type proton ATPase catalytic subunit A OS=Trypanosoma congolense PE=2 SV=1 21 610 0.0E+00
sp|Q40002|VATA_HORVU V-type proton ATPase catalytic subunit A (Fragment) OS=Hordeum vulgare PE=2 SV=1 43 612 0.0E+00
sp|Q8SQU9|VATA_ENCCU V-type proton ATPase catalytic subunit A OS=Encephalitozoon cuniculi (strain GB-M1) GN=VMA1 PE=1 SV=1 13 581 0.0E+00
sp|P49087|VATA_MAIZE V-type proton ATPase catalytic subunit A (Fragment) OS=Zea mays PE=2 SV=1 63 612 0.0E+00
sp|Q03498|VATA_PLAFA V-type proton ATPase catalytic subunit A OS=Plasmodium falciparum GN=vapA PE=3 SV=1 21 612 0.0E+00
sp|Q76NM6|VATA_PLAF7 V-type proton ATPase catalytic subunit A OS=Plasmodium falciparum (isolate 3D7) GN=vapA PE=3 SV=1 21 612 0.0E+00
sp|Q72J72|VATA_THET2 V-type ATP synthase alpha chain OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=atpA PE=3 SV=1 20 561 0.0E+00
sp|Q56403|VATA_THET8 V-type ATP synthase alpha chain OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=atpA PE=1 SV=2 20 561 0.0E+00
sp|O32466|VATA_THESI V-type ATP synthase alpha chain OS=Thermococcus sp. (strain KI) GN=atpA PE=3 SV=1 21 608 0.0E+00
sp|C5A336|VATA_THEGJ V-type ATP synthase alpha chain OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=atpA PE=3 SV=1 21 607 0.0E+00
sp|Q1IWP3|VATA_DEIGD V-type ATP synthase alpha chain OS=Deinococcus geothermalis (strain DSM 11300) GN=atpA PE=3 SV=1 19 559 0.0E+00
sp|Q8TWL6|VATA_METKA V-type ATP synthase alpha chain OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=atpA PE=3 SV=1 18 612 0.0E+00
sp|O27036|VATA_METTH V-type ATP synthase alpha chain OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=atpA PE=3 SV=1 18 565 0.0E+00
sp|Q2NF87|VATA_METST V-type ATP synthase alpha chain OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=atpA PE=3 SV=1 21 602 0.0E+00
sp|Q57670|VATA_METJA V-type ATP synthase alpha chain OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=atpA PE=3 SV=2 21 609 0.0E+00
sp|O06504|VATA_DESSY V-type ATP synthase alpha chain OS=Desulfurococcus sp. (strain SY) GN=atpA PE=3 SV=1 21 608 0.0E+00
sp|Q9RWG8|VATA_DEIRA V-type ATP synthase alpha chain OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=atpA PE=3 SV=1 20 559 0.0E+00
sp|A6VFZ2|VATA_METM7 V-type ATP synthase alpha chain OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=atpA PE=3 SV=1 21 610 0.0E+00
sp|A9AAQ4|VATA_METM6 V-type ATP synthase alpha chain OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=atpA PE=3 SV=1 21 610 0.0E+00
sp|Q6LYE7|VATA_METMP V-type ATP synthase alpha chain OS=Methanococcus maripaludis (strain S2 / LL) GN=atpA PE=3 SV=1 21 600 0.0E+00
sp|A2BKX6|VATA_HYPBU V-type ATP synthase alpha chain OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=atpA PE=3 SV=1 21 604 0.0E+00
sp|A6UT35|VATA_META3 V-type ATP synthase alpha chain OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=atpA PE=3 SV=1 21 602 0.0E+00
sp|A4FXD4|VATA_METM5 V-type ATP synthase alpha chain OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=atpA PE=3 SV=1 21 600 0.0E+00
sp|A6UP54|VATA_METVS V-type ATP synthase alpha chain OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=atpA PE=3 SV=1 21 610 0.0E+00
sp|C1CXU3|VATA_DEIDV V-type ATP synthase alpha chain OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=atpA PE=3 SV=1 18 561 0.0E+00
sp|C3NEU3|VATA_SULIY V-type ATP synthase alpha chain OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=atpA PE=3 SV=1 19 612 0.0E+00
sp|C3MQL5|VATA_SULIL V-type ATP synthase alpha chain OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=atpA PE=3 SV=1 19 612 0.0E+00
sp|C3MW93|VATA_SULIM V-type ATP synthase alpha chain OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=atpA PE=3 SV=1 19 612 0.0E+00
sp|C4KHV0|VATA_SULIK V-type ATP synthase alpha chain OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=atpA PE=3 SV=1 19 612 0.0E+00
sp|C3N6D5|VATA_SULIA V-type ATP synthase alpha chain OS=Sulfolobus islandicus (strain M.16.27) GN=atpA PE=3 SV=1 19 612 0.0E+00
sp|C3NGV1|VATA_SULIN V-type ATP synthase alpha chain OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=atpA PE=3 SV=1 19 612 0.0E+00
sp|Q971B7|VATA_SULTO V-type ATP synthase alpha chain OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=atpA PE=1 SV=3 20 612 0.0E+00
sp|B6YV14|VATA_THEON V-type ATP synthase alpha chain OS=Thermococcus onnurineus (strain NA1) GN=atpA PE=3 SV=1 21 608 0.0E+00
sp|B0K8E8|VATA_THEP3 V-type ATP synthase alpha chain OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=atpA PE=3 SV=1 20 565 0.0E+00
sp|B0K5J0|VATA_THEPX V-type ATP synthase alpha chain OS=Thermoanaerobacter sp. (strain X514) GN=atpA PE=3 SV=1 20 565 0.0E+00
sp|Q5JIR3|VATA_THEKO V-type ATP synthase alpha chain OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=atpA PE=3 SV=1 21 608 0.0E+00
sp|Q9UWW6|VATA_SULSO V-type ATP synthase alpha chain OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=atpA PE=3 SV=1 20 612 0.0E+00
sp|Q1J8S5|VATA_STRPF V-type ATP synthase alpha chain OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=atpA PE=3 SV=1 19 607 0.0E+00
sp|Q5XE50|VATA_STRP6 V-type ATP synthase alpha chain OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=atpA PE=3 SV=2 19 607 0.0E+00
sp|Q9A1Q3|VATA_STRP1 V-type ATP synthase alpha chain OS=Streptococcus pyogenes serotype M1 GN=atpA PE=3 SV=1 19 607 0.0E+00
sp|A8AC29|VATA_IGNH4 V-type ATP synthase alpha chain OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=atpA PE=3 SV=1 21 609 0.0E+00
sp|Q48VL3|VATA_STRPM V-type ATP synthase alpha chain OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=atpA PE=3 SV=1 19 607 0.0E+00
sp|Q12WL1|VATA_METBU V-type ATP synthase alpha chain OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=atpA PE=3 SV=1 20 609 0.0E+00
sp|Q1JIX5|VATA_STRPD V-type ATP synthase alpha chain OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=atpA PE=3 SV=1 19 607 0.0E+00
sp|Q1JNS8|VATA_STRPC V-type ATP synthase alpha chain OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=atpA PE=3 SV=1 19 607 0.0E+00
sp|Q1JDX0|VATA_STRPB V-type ATP synthase alpha chain OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=atpA PE=3 SV=1 19 607 0.0E+00
sp|A2RC97|VATA_STRPG V-type ATP synthase alpha chain OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=atpA PE=3 SV=1 19 607 0.0E+00
sp|P0DA07|VATA_STRPQ V-type ATP synthase alpha chain OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=atpA PE=3 SV=1 19 607 0.0E+00
sp|P0DA06|VATA_STRP3 V-type ATP synthase alpha chain OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=atpA PE=3 SV=1 19 607 0.0E+00
sp|Q8P2U6|VATA_STRP8 V-type ATP synthase alpha chain OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=atpA PE=3 SV=1 19 607 0.0E+00
sp|Q4J8L9|VATA_SULAC V-type ATP synthase alpha chain OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=atpA PE=3 SV=1 20 612 0.0E+00
sp|Q0W363|VATA_METAR V-type ATP synthase alpha chain OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=atpA PE=3 SV=1 18 587 0.0E+00
sp|A4YI05|VATA_METS5 V-type ATP synthase alpha chain OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=atpA PE=3 SV=1 20 559 0.0E+00
sp|B5XJH3|VATA_STRPZ V-type ATP synthase alpha chain OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=atpA PE=3 SV=1 19 607 0.0E+00
sp|A7IAU8|VATA_METB6 V-type ATP synthase alpha chain OS=Methanoregula boonei (strain 6A8) GN=atpA PE=3 SV=1 7 581 0.0E+00
sp|Q0SSI2|VATA_CLOPS V-type ATP synthase alpha chain OS=Clostridium perfringens (strain SM101 / Type A) GN=atpA PE=3 SV=1 21 565 0.0E+00
sp|A3DHP0|VATA_CLOTH V-type ATP synthase alpha chain OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=atpA PE=3 SV=1 20 610 0.0E+00
sp|Q8XJW5|VATA_CLOPE V-type ATP synthase alpha chain OS=Clostridium perfringens (strain 13 / Type A) GN=atpA PE=3 SV=1 21 565 0.0E+00
sp|Q0TPW7|VATA_CLOP1 V-type ATP synthase alpha chain OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=atpA PE=3 SV=1 21 565 0.0E+00
sp|A7GGL4|VATA_CLOBL V-type ATP synthase alpha chain OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=atpA PE=3 SV=2 21 559 0.0E+00
sp|B1IJM8|VATA_CLOBK V-type ATP synthase alpha chain OS=Clostridium botulinum (strain Okra / Type B1) GN=atpA PE=3 SV=1 21 559 0.0E+00
sp|B1KXT6|VATA_CLOBM V-type ATP synthase alpha chain OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=atpA PE=3 SV=1 21 559 0.0E+00
sp|A5UKB2|VATA_METS3 V-type ATP synthase alpha chain OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=atpA PE=3 SV=1 20 559 0.0E+00
sp|Q2FL43|VATA2_METHJ V-type ATP synthase alpha chain 2 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=atpA2 PE=3 SV=1 21 556 0.0E+00
sp|B2UWY4|VATA_CLOBA V-type ATP synthase alpha chain OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=atpA PE=3 SV=1 21 581 0.0E+00
sp|A5I557|VATA_CLOBH V-type ATP synthase alpha chain OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=atpA PE=3 SV=2 21 559 0.0E+00
sp|A7FWQ7|VATA_CLOB1 V-type ATP synthase alpha chain OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=atpA PE=3 SV=2 21 559 0.0E+00
sp|A3CS71|VATA_METMJ V-type ATP synthase alpha chain OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=atpA PE=3 SV=1 20 581 0.0E+00
sp|A3CK48|VATA_STRSV V-type ATP synthase alpha chain OS=Streptococcus sanguinis (strain SK36) GN=atpA PE=3 SV=2 20 581 0.0E+00
sp|B2TP91|VATA_CLOBB V-type ATP synthase alpha chain OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=atpA PE=3 SV=1 21 581 0.0E+00
sp|A8AUJ7|VATA_STRGC V-type ATP synthase alpha chain OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=atpA PE=3 SV=1 20 581 0.0E+00
sp|C6A5E8|VATA_THESM V-type ATP synthase alpha chain OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=atpA PE=3 SV=1 21 559 0.0E+00
sp|Q9YF35|VATA_AERPE V-type ATP synthase alpha chain OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=atpA PE=3 SV=2 21 591 0.0E+00
sp|B5E552|VATA_STRP4 V-type ATP synthase alpha chain OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=atpA PE=3 SV=1 20 581 0.0E+00
sp|C1CES2|VATA_STRZJ V-type ATP synthase alpha chain OS=Streptococcus pneumoniae (strain JJA) GN=atpA PE=3 SV=1 20 581 0.0E+00
sp|Q97QA8|VATA_STRPN V-type ATP synthase alpha chain OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=atpA PE=3 SV=1 20 581 0.0E+00
sp|B8ZK31|VATA_STRPJ V-type ATP synthase alpha chain OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=atpA PE=3 SV=1 20 581 0.0E+00
sp|A0PZC6|VATA_CLONN V-type ATP synthase alpha chain OS=Clostridium novyi (strain NT) GN=atpA PE=3 SV=1 21 581 0.0E+00
sp|B1ICC9|VATA_STRPI V-type ATP synthase alpha chain OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=atpA PE=3 SV=1 20 581 0.0E+00
sp|Q08636|NTPA_ENTHA V-type sodium ATPase catalytic subunit A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=ntpA PE=1 SV=1 21 612 0.0E+00
sp|Q834X9|VATA_ENTFA V-type ATP synthase alpha chain OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=atpA PE=3 SV=2 21 586 0.0E+00
sp|P22662|VATA_METBA V-type ATP synthase alpha chain OS=Methanosarcina barkeri GN=atpA PE=3 SV=1 21 609 0.0E+00
sp|Q2FQE9|VATA3_METHJ V-type ATP synthase alpha chain 3 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=atpA3 PE=3 SV=1 20 566 0.0E+00
sp|Q896K4|VATA1_CLOTE V-type ATP synthase alpha chain 1 OS=Clostridium tetani (strain Massachusetts / E88) GN=atpA1 PE=3 SV=1 21 559 0.0E+00
sp|Q46FH3|VATA_METBF V-type ATP synthase alpha chain OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=atpA PE=3 SV=1 21 609 0.0E+00
sp|Q74MJ7|VATA_NANEQ V-type ATP synthase alpha chain OS=Nanoarchaeum equitans (strain Kin4-M) GN=atpA PE=1 SV=1 22 549 0.0E+00
sp|Q891P1|VATA2_CLOTE V-type ATP synthase alpha chain 2 OS=Clostridium tetani (strain Massachusetts / E88) GN=atpA2 PE=3 SV=1 21 606 0.0E+00
sp|A1RX21|VATA_THEPD V-type ATP synthase alpha chain OS=Thermofilum pendens (strain Hrk 5) GN=atpA PE=3 SV=1 19 558 0.0E+00
sp|Q5UXY8|VATA_HALMA V-type ATP synthase alpha chain OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=atpA PE=3 SV=1 14 606 0.0E+00
sp|Q3ITC8|VATA_NATPD V-type ATP synthase alpha chain OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=atpA PE=3 SV=1 18 559 0.0E+00
sp|Q9HNE3|VATA_HALSA V-type ATP synthase alpha chain OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=atpA PE=1 SV=1 21 606 0.0E+00
sp|B0R755|VATA_HALS3 V-type ATP synthase alpha chain OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=atpA PE=3 SV=1 21 606 0.0E+00
sp|Q2FP52|VATA1_METHJ V-type ATP synthase alpha chain 1 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=atpA1 PE=3 SV=1 21 581 0.0E+00
sp|A2SST5|VATA_METLZ V-type ATP synthase alpha chain OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=atpA PE=3 SV=1 18 545 0.0E+00
sp|A3DNQ6|VATA_STAMF V-type ATP synthase alpha chain OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=atpA PE=3 SV=1 21 612 0.0E+00
sp|Q60186|VATA_METMA V-type ATP synthase alpha chain OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=atpA PE=1 SV=2 21 582 0.0E+00
sp|B8CZG8|VATA_HALOH V-type ATP synthase alpha chain OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=atpA PE=3 SV=1 21 585 0.0E+00
sp|Q184E7|VATA_PEPD6 V-type ATP synthase alpha chain OS=Peptoclostridium difficile (strain 630) GN=atpA PE=3 SV=1 21 558 0.0E+00
sp|Q8TIJ1|VATA_METAC V-type ATP synthase alpha chain OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=atpA PE=3 SV=1 21 587 0.0E+00
sp|Q48332|VATA_HALVD V-type ATP synthase alpha chain OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=atpA PE=1 SV=1 21 559 0.0E+00
sp|A9A2R0|VATA_NITMS V-type ATP synthase alpha chain OS=Nitrosopumilus maritimus (strain SCM1) GN=atpA PE=3 SV=1 20 609 0.0E+00
sp|Q18FB7|VATA_HALWD V-type ATP synthase alpha chain OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=atpA PE=3 SV=1 21 606 0.0E+00
sp|O29101|VATA_ARCFU V-type ATP synthase alpha chain OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=atpA PE=3 SV=1 16 561 0.0E+00
sp|A0RXK1|VATA_CENSY V-type ATP synthase alpha chain OS=Cenarchaeum symbiosum (strain A) GN=atpA PE=3 SV=1 18 612 0.0E+00
sp|A0B9K2|VATA_METTP V-type ATP synthase alpha chain OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=atpA PE=3 SV=1 21 580 2.0E-178
sp|A4WN96|VATA_PYRAR V-type ATP synthase alpha chain OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=atpA PE=3 SV=1 21 607 2.0E-171
sp|A1RSF1|VATA_PYRIL V-type ATP synthase alpha chain OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=atpA PE=3 SV=1 21 602 7.0E-171
sp|A7HDG9|VATA_ANADF V-type ATP synthase alpha chain OS=Anaeromyxobacter sp. (strain Fw109-5) GN=atpA PE=3 SV=1 22 612 2.0E-170
sp|A3MXY7|VATA_PYRCJ V-type ATP synthase alpha chain OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=atpA PE=3 SV=1 21 602 4.0E-170
sp|P38078|VATA_CANTR V-type proton ATPase catalytic subunit A OS=Candida tropicalis GN=VMA1 PE=3 SV=1 256 607 5.0E-169
sp|P17255|VATA_YEAST V-type proton ATPase catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA1 PE=1 SV=3 256 611 3.0E-168
sp|Q8ZYR1|VATA_PYRAE V-type ATP synthase alpha chain OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=atpA PE=3 SV=1 21 602 2.0E-167
sp|B4UH39|VATA_ANASK V-type ATP synthase alpha chain OS=Anaeromyxobacter sp. (strain K) GN=atpA PE=3 SV=1 21 559 3.0E-166
sp|B1YC22|VATA_PYRNV V-type ATP synthase alpha chain OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=atpA PE=3 SV=1 21 608 6.0E-166
sp|Q2IQ95|VATA_ANADE V-type ATP synthase alpha chain OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=atpA PE=3 SV=1 21 559 8.0E-166
sp|B8JE35|VATA_ANAD2 V-type ATP synthase alpha chain OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=atpA PE=3 SV=1 21 559 6.0E-165
sp|O83541|VATA2_TREPA V-type ATP synthase alpha chain 2 OS=Treponema pallidum (strain Nichols) GN=atpA2 PE=3 SV=1 21 606 6.0E-161
sp|Q3J9F3|VATA_NITOC V-type ATP synthase alpha chain OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=atpA PE=3 SV=1 21 559 5.0E-159
sp|Q6MAJ5|VATA_PARUW V-type ATP synthase alpha chain OS=Protochlamydia amoebophila (strain UWE25) GN=atpA PE=3 SV=1 44 605 7.0E-135
sp|B5RQS2|VATA_BORRA V-type ATP synthase alpha chain OS=Borrelia recurrentis (strain A1) GN=atpA PE=3 SV=1 21 545 5.0E-132
sp|B5RLG8|VATA_BORDL V-type ATP synthase alpha chain OS=Borrelia duttonii (strain Ly) GN=atpA PE=3 SV=1 21 545 1.0E-131
sp|B2S1S8|VATA_BORHD V-type ATP synthase alpha chain OS=Borrelia hermsii (strain HS1 / DAH) GN=atpA PE=3 SV=1 20 545 3.0E-131
sp|P17255|VATA_YEAST V-type proton ATPase catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA1 PE=1 SV=3 14 285 5.0E-131
sp|P38078|VATA_CANTR V-type proton ATPase catalytic subunit A OS=Candida tropicalis GN=VMA1 PE=3 SV=1 14 298 3.0E-130
sp|Q73M28|VATA_TREDE V-type ATP synthase alpha chain OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=atpA PE=3 SV=1 21 612 1.0E-128
sp|A1QYP3|VATA_BORT9 V-type ATP synthase alpha chain OS=Borrelia turicatae (strain 91E135) GN=atpA PE=3 SV=1 20 545 4.0E-128
sp|Q0SP70|VATA_BORAP V-type ATP synthase alpha chain OS=Borrelia afzelii (strain PKo) GN=atpA PE=3 SV=2 21 545 6.0E-127
sp|O51121|VATA_BORBU V-type ATP synthase alpha chain OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=atpA PE=3 SV=2 21 545 2.0E-126
sp|B7J127|VATA_BORBZ V-type ATP synthase alpha chain OS=Borrelia burgdorferi (strain ZS7) GN=atpA PE=3 SV=1 21 545 8.0E-126
sp|Q662R8|VATA_BORBP V-type ATP synthase alpha chain OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=atpA PE=3 SV=1 21 545 3.0E-125
sp|Q9PK85|VATA_CHLMU V-type ATP synthase alpha chain OS=Chlamydia muridarum (strain MoPn / Nigg) GN=atpA PE=3 SV=1 45 545 2.0E-124
sp|O84310|VATA_CHLTR V-type ATP synthase alpha chain OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=atpA PE=3 SV=1 45 545 9.0E-123
sp|Q3KM54|VATA_CHLTA V-type ATP synthase alpha chain OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=atpA PE=3 SV=1 45 545 9.0E-123
sp|O83441|VATA1_TREPA V-type ATP synthase alpha chain 1 OS=Treponema pallidum (strain Nichols) GN=atpA1 PE=3 SV=1 20 537 2.0E-122
sp|B0BBT9|VATA_CHLTB V-type ATP synthase alpha chain OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=atpA PE=3 SV=1 45 545 3.0E-122
sp|B0B7M4|VATA_CHLT2 V-type ATP synthase alpha chain OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=atpA PE=3 SV=1 45 545 3.0E-122
sp|Q9Z993|VATA_CHLPN V-type ATP synthase alpha chain OS=Chlamydia pneumoniae GN=atpA PE=3 SV=1 45 550 1.0E-120
sp|Q822J8|VATA_CHLCV V-type ATP synthase alpha chain OS=Chlamydophila caviae (strain GPIC) GN=atpA PE=3 SV=1 45 550 7.0E-119
sp|Q5L5J0|VATA_CHLAB V-type ATP synthase alpha chain OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=atpA PE=3 SV=1 45 580 6.0E-118
sp|Q9UXU7|VATA_PYRAB V-type ATP synthase alpha chain OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=atpA PE=3 SV=1 258 608 1.0E-109
sp|O57728|VATA_PYRHO V-type ATP synthase alpha chain OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=atpA PE=1 SV=1 258 608 4.0E-109
sp|Q8U4A6|VATA_PYRFU V-type ATP synthase alpha chain OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=atpA PE=3 SV=1 258 608 7.0E-109
sp|Q9P997|VATA_THEAC V-type ATP synthase alpha chain OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=atpA PE=2 SV=2 234 601 7.0E-106
sp|Q97CQ0|VATA_THEVO V-type ATP synthase alpha chain OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=atpA PE=1 SV=1 234 612 3.0E-105
sp|Q8U4A6|VATA_PYRFU V-type ATP synthase alpha chain OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=atpA PE=3 SV=1 21 259 4.0E-73
sp|Q9UXU7|VATA_PYRAB V-type ATP synthase alpha chain OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=atpA PE=3 SV=1 21 259 1.0E-72
sp|O57728|VATA_PYRHO V-type ATP synthase alpha chain OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=atpA PE=1 SV=1 21 259 2.0E-71
sp|Q9P997|VATA_THEAC V-type ATP synthase alpha chain OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=atpA PE=2 SV=2 21 291 2.0E-67
sp|Q97CQ0|VATA_THEVO V-type ATP synthase alpha chain OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=atpA PE=1 SV=1 21 259 3.0E-63
sp|P42467|ATPB_PEPNI ATP synthase subunit beta (Fragment) OS=Peptococcus niger GN=atpD PE=3 SV=1 130 526 8.0E-34
sp|B8G6G6|ATPB_CHLAD ATP synthase subunit beta OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=atpD PE=3 SV=1 198 550 4.0E-33
sp|Q6AG58|ATPB_LEIXX ATP synthase subunit beta OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=atpD PE=3 SV=1 206 582 5.0E-33
sp|B9LBM0|ATPB_CHLSY ATP synthase subunit beta OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=atpD PE=3 SV=1 198 550 1.0E-32
sp|A9WGS4|ATPB_CHLAA ATP synthase subunit beta OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=atpD PE=3 SV=1 198 550 1.0E-32
sp|A4ITI9|ATPB_GEOTN ATP synthase subunit beta OS=Geobacillus thermodenitrificans (strain NG80-2) GN=atpD PE=3 SV=1 211 533 2.0E-32
sp|Q5KUJ3|ATPB_GEOKA ATP synthase subunit beta OS=Geobacillus kaustophilus (strain HTA426) GN=atpD PE=1 SV=1 211 533 5.0E-32
sp|Q9LA80|ATPB_GEOTH ATP synthase subunit beta OS=Geobacillus thermoleovorans GN=atpD PE=3 SV=1 211 533 6.0E-32
sp|Q6A8C7|ATPB_PROAC ATP synthase subunit beta OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=atpD PE=3 SV=1 208 527 8.0E-32
sp|B8DWS2|ATPB_BIFA0 ATP synthase subunit beta OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=atpD PE=3 SV=1 208 526 1.0E-31
sp|C5D990|ATPB_GEOSW ATP synthase subunit beta OS=Geobacillus sp. (strain WCH70) GN=atpD PE=3 SV=1 211 533 1.0E-31
sp|B0RED4|ATPB_CLAMS ATP synthase subunit beta OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=atpD PE=3 SV=1 206 526 1.0E-31
sp|A5CQ60|ATPB_CLAM3 ATP synthase subunit beta OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=atpD PE=3 SV=1 206 526 1.0E-31
sp|A6W7G9|ATPB_KINRD ATP synthase subunit beta OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=atpD PE=3 SV=1 208 526 1.0E-31
sp|P42006|ATPB_GEOSE ATP synthase subunit beta OS=Geobacillus stearothermophilus GN=atpD PE=3 SV=1 211 533 2.0E-31
sp|B7GTZ3|ATPB_BIFLS ATP synthase subunit beta OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=atpD PE=3 SV=1 208 526 2.0E-31
sp|P07677|ATPB_BACP3 ATP synthase subunit beta OS=Bacillus sp. (strain PS3) GN=atpD PE=1 SV=1 211 533 2.0E-31
sp|B5Z8D0|ATPB_HELPG ATP synthase subunit beta OS=Helicobacter pylori (strain G27) GN=atpD PE=3 SV=1 172 523 3.0E-31
sp|P0A1C2|SPAL_SHISO Probable ATP synthase SpaL/MxiB OS=Shigella sonnei GN=spaL PE=3 SV=1 215 524 3.0E-31
sp|P0A1C1|SPAL_SHIFL Probable ATP synthase SpaL/MxiB OS=Shigella flexneri GN=spaL PE=3 SV=1 215 524 3.0E-31
sp|Q9ZK81|ATPB_HELPJ ATP synthase subunit beta OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=atpD PE=3 SV=1 172 523 4.0E-31
sp|P55988|ATPB_HELPY ATP synthase subunit beta OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=atpD PE=3 SV=1 172 523 4.0E-31
sp|B6JMX2|ATPB_HELP2 ATP synthase subunit beta OS=Helicobacter pylori (strain P12) GN=atpD PE=3 SV=1 172 523 5.0E-31
sp|Q8XID4|ATPB_CLOPE ATP synthase subunit beta OS=Clostridium perfringens (strain 13 / Type A) GN=atpD PE=3 SV=1 208 550 6.0E-31
sp|Q0TNC4|ATPB_CLOP1 ATP synthase subunit beta OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=atpD PE=3 SV=1 208 550 6.0E-31
sp|Q0SQZ5|ATPB_CLOPS ATP synthase subunit beta OS=Clostridium perfringens (strain SM101 / Type A) GN=atpD PE=3 SV=1 208 550 7.0E-31
sp|Q8G7B3|ATPB_BIFLO ATP synthase subunit beta OS=Bifidobacterium longum (strain NCC 2705) GN=atpD PE=3 SV=1 208 526 7.0E-31
sp|B3DTV0|ATPB_BIFLD ATP synthase subunit beta OS=Bifidobacterium longum (strain DJO10A) GN=atpD PE=3 SV=1 208 526 7.0E-31
sp|P40291|YSCN_YERPS Probable ATP synthase YscN OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=yscN PE=1 SV=2 204 496 1.0E-30
sp|P40290|YSCN_YEREN Probable ATP synthase YscN OS=Yersinia enterocolitica GN=yscN PE=1 SV=1 204 496 1.0E-30
sp|B9IRT7|ATPB_BACCQ ATP synthase subunit beta OS=Bacillus cereus (strain Q1) GN=atpD PE=3 SV=1 195 533 1.0E-30
sp|B7HY64|ATPB_BACC7 ATP synthase subunit beta OS=Bacillus cereus (strain AH187) GN=atpD PE=3 SV=1 195 533 1.0E-30
sp|Q72XE8|ATPB_BACC1 ATP synthase subunit beta OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=atpD PE=3 SV=1 195 533 1.0E-30
sp|A7NIQ9|ATPB_ROSCS ATP synthase subunit beta OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=atpD PE=3 SV=1 202 547 1.0E-30
sp|A1A3C5|ATPB_BIFAA ATP synthase subunit beta OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=atpD PE=3 SV=1 206 526 1.0E-30
sp|P41009|ATPB_BACCA ATP synthase subunit beta OS=Bacillus caldotenax GN=atpD PE=3 SV=1 211 533 1.0E-30
sp|Q9Z687|ATPB_CLOAB ATP synthase subunit beta OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=atpD PE=3 SV=1 210 533 1.0E-30
sp|A7G9Q9|ATPB_CLOBL ATP synthase subunit beta OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=atpD PE=3 SV=1 203 550 2.0E-30
sp|B1IE34|ATPB_CLOBK ATP synthase subunit beta OS=Clostridium botulinum (strain Okra / Type B1) GN=atpD PE=3 SV=1 203 550 2.0E-30
sp|A7GV56|ATPB_BACCN ATP synthase subunit beta OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=atpD PE=3 SV=1 131 551 2.0E-30
sp|Q1CSD5|ATPB_HELPH ATP synthase subunit beta OS=Helicobacter pylori (strain HPAG1) GN=atpD PE=3 SV=2 172 523 2.0E-30
sp|Q17Y78|ATPB_HELAH ATP synthase subunit beta OS=Helicobacter acinonychis (strain Sheeba) GN=atpD PE=3 SV=1 172 523 2.0E-30
sp|A7H017|ATPB_CAMC5 ATP synthase subunit beta OS=Campylobacter curvus (strain 525.92) GN=atpD PE=3 SV=1 208 523 2.0E-30
sp|A5HY52|ATPB_CLOBH ATP synthase subunit beta OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=atpD PE=3 SV=1 203 550 2.0E-30
sp|C3KYJ3|ATPB_CLOB6 ATP synthase subunit beta OS=Clostridium botulinum (strain 657 / Type Ba4) GN=atpD PE=3 SV=1 203 550 2.0E-30
sp|A7FQH9|ATPB_CLOB1 ATP synthase subunit beta OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=atpD PE=3 SV=1 203 550 2.0E-30
sp|C1FQP5|ATPB_CLOBJ ATP synthase subunit beta OS=Clostridium botulinum (strain Kyoto / Type A2) GN=atpD PE=3 SV=1 203 550 3.0E-30
sp|A1SHJ1|ATPB_NOCSJ ATP synthase subunit beta OS=Nocardioides sp. (strain BAA-499 / JS614) GN=atpD PE=3 SV=1 204 526 3.0E-30
sp|B7IQV8|ATPB_BACC2 ATP synthase subunit beta OS=Bacillus cereus (strain G9842) GN=atpD PE=3 SV=1 195 533 3.0E-30
sp|B8HAY9|ATPB_ARTCA ATP synthase subunit beta OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=atpD PE=3 SV=1 191 569 4.0E-30
sp|Q814W2|ATPB_BACCR ATP synthase subunit beta OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=atpD PE=3 SV=1 195 533 4.0E-30
sp|B7HFK1|ATPB_BACC4 ATP synthase subunit beta OS=Bacillus cereus (strain B4264) GN=atpD PE=3 SV=1 195 533 4.0E-30
sp|Q9CES0|ATPB_LACLA ATP synthase subunit beta OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=atpD PE=3 SV=1 211 551 4.0E-30
sp|Q6HAY0|ATPB_BACHK ATP synthase subunit beta OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=atpD PE=3 SV=1 195 533 4.0E-30
sp|Q630U3|ATPB_BACCZ ATP synthase subunit beta OS=Bacillus cereus (strain ZK / E33L) GN=atpD PE=3 SV=1 195 533 4.0E-30
sp|C1F0M8|ATPB_BACC3 ATP synthase subunit beta OS=Bacillus cereus (strain 03BB102) GN=atpD PE=3 SV=1 195 533 4.0E-30
sp|Q81JZ5|ATPB_BACAN ATP synthase subunit beta OS=Bacillus anthracis GN=atpD PE=3 SV=1 195 533 4.0E-30
sp|A0RL95|ATPB_BACAH ATP synthase subunit beta OS=Bacillus thuringiensis (strain Al Hakam) GN=atpD PE=3 SV=1 195 533 4.0E-30
sp|C3LFH9|ATPB_BACAC ATP synthase subunit beta OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=atpD PE=3 SV=1 195 533 4.0E-30
sp|C3P1F4|ATPB_BACAA ATP synthase subunit beta OS=Bacillus anthracis (strain A0248) GN=atpD PE=3 SV=1 195 533 4.0E-30
sp|Q02XA5|ATPB_LACLS ATP synthase subunit beta OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=atpD PE=3 SV=1 211 551 4.0E-30
sp|B7JGN0|ATPB_BACC0 ATP synthase subunit beta OS=Bacillus cereus (strain AH820) GN=atpD PE=3 SV=1 195 533 5.0E-30
sp|A9WNC8|ATPB_RENSM ATP synthase subunit beta OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=atpD PE=3 SV=2 191 569 5.0E-30
sp|B2UZK0|ATPB_CLOBA ATP synthase subunit beta OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=atpD PE=3 SV=1 210 523 5.0E-30
sp|A2RMI2|ATPB_LACLM ATP synthase subunit beta OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=atpD PE=3 SV=2 211 551 5.0E-30
sp|B2TK00|ATPB_CLOBB ATP synthase subunit beta OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=atpD PE=3 SV=1 210 523 5.0E-30
sp|Q47M82|ATPB_THEFY ATP synthase subunit beta OS=Thermobifida fusca (strain YX) GN=atpD PE=3 SV=1 198 526 6.0E-30
sp|P42466|ATPB_HERAU ATP synthase subunit beta OS=Herpetosiphon aurantiacus GN=atpD PE=3 SV=1 208 528 7.0E-30
sp|A0Q2Z4|ATPB_CLONN ATP synthase subunit beta OS=Clostridium novyi (strain NT) GN=atpD PE=3 SV=1 203 533 7.0E-30
sp|A9AVV4|ATPB_HERA2 ATP synthase subunit beta OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=atpD PE=3 SV=1 208 528 8.0E-30
sp|A7ZC37|ATPB_CAMC1 ATP synthase subunit beta OS=Campylobacter concisus (strain 13826) GN=atpD PE=3 SV=1 208 523 8.0E-30
sp|P42470|ATPB_WOLSU ATP synthase subunit beta OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=atpD PE=3 SV=1 210 523 8.0E-30
sp|A5UQN3|ATPB_ROSS1 ATP synthase subunit beta OS=Roseiflexus sp. (strain RS-1) GN=atpD PE=3 SV=1 202 547 8.0E-30
sp|Q6MS94|ATPB_MYCMS ATP synthase subunit beta OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=atpD PE=3 SV=1 207 526 1.0E-29
sp|A9VSA3|ATPB_BACWK ATP synthase subunit beta OS=Bacillus weihenstephanensis (strain KBAB4) GN=atpD PE=3 SV=1 195 533 1.0E-29
sp|Q7VJ21|ATPB_HELHP ATP synthase subunit beta OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=atpD PE=3 SV=1 172 523 1.0E-29
sp|P55717|Y4YI_RHISN Probable ATP synthase y4yI OS=Rhizobium sp. (strain NGR234) GN=NGR_a00640 PE=3 SV=1 197 544 2.0E-29
sp|Q2ST34|ATPB_MYCCT ATP synthase subunit beta OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=atpD PE=3 SV=1 207 526 3.0E-29
sp|A4QDH3|ATPB_CORGB ATP synthase subunit beta OS=Corynebacterium glutamicum (strain R) GN=atpD PE=3 SV=1 205 526 3.0E-29
sp|B1KSS8|ATPB_CLOBM ATP synthase subunit beta OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=atpD PE=3 SV=1 203 550 3.0E-29
sp|P42464|ATPB_CORGL ATP synthase subunit beta OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=atpD PE=3 SV=2 205 526 3.0E-29
sp|Q8EM83|ATPB_OCEIH ATP synthase subunit beta OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=atpD PE=3 SV=1 211 533 3.0E-29
sp|P12698|ATPB_BACMQ ATP synthase subunit beta OS=Bacillus megaterium (strain ATCC 12872 / QMB1551) GN=atpD PE=3 SV=2 211 533 4.0E-29
sp|Q9I4N1|FLII_PSEAE Flagellum-specific ATP synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fliI PE=3 SV=1 226 524 4.0E-29
sp|A9NGW2|ATPB_ACHLI ATP synthase subunit beta OS=Acholeplasma laidlawii (strain PG-8A) GN=atpD PE=3 SV=1 210 551 4.0E-29
sp|B1VFY7|ATPB_CORU7 ATP synthase subunit beta OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=atpD PE=3 SV=1 208 526 5.0E-29
sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthrobacter aurescens (strain TC1) GN=atpD PE=3 SV=2 210 569 6.0E-29
sp|B7GMF3|ATPB_ANOFW ATP synthase subunit beta OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=atpD PE=3 SV=1 215 533 6.0E-29
sp|Q6KI82|ATPB_MYCMO ATP synthase subunit beta OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=atpD PE=3 SV=1 205 523 6.0E-29
sp|Q5GRU7|ATPB_WOLTR ATP synthase subunit beta OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=atpD PE=3 SV=2 131 522 7.0E-29
sp|B9E8E6|ATPB_MACCJ ATP synthase subunit beta OS=Macrococcus caseolyticus (strain JCSC5402) GN=atpD PE=3 SV=1 190 533 9.0E-29
sp|B9KES3|ATPB_CAMLR ATP synthase subunit beta OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=atpD PE=3 SV=1 208 523 9.0E-29
sp|Q8E5U8|ATPB_STRA3 ATP synthase subunit beta OS=Streptococcus agalactiae serotype III (strain NEM316) GN=atpD PE=3 SV=1 130 524 1.0E-28
sp|A7H1I1|ATPB_CAMJD ATP synthase subunit beta OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=atpD PE=3 SV=1 203 523 2.0E-28
sp|Q5FRC5|ATPB1_GLUOX ATP synthase subunit beta 1 OS=Gluconobacter oxydans (strain 621H) GN=atpD1 PE=3 SV=1 210 523 2.0E-28
sp|C3PFR5|ATPB_CORA7 ATP synthase subunit beta OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=atpD PE=3 SV=1 208 526 2.0E-28
sp|Q8FQ20|ATPB_COREF ATP synthase subunit beta OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=atpD PE=3 SV=1 208 526 2.0E-28
sp|Q8E072|ATPB_STRA5 ATP synthase subunit beta OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=atpD PE=3 SV=1 191 524 2.0E-28
sp|Q3K1J5|ATPB_STRA1 ATP synthase subunit beta OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=atpD PE=3 SV=1 191 524 2.0E-28
sp|P80153|HRPB6_XANEU Probable ATP synthase hrpB6 OS=Xanthomonas euvesicatoria GN=hrpB6 PE=3 SV=1 215 523 2.0E-28
sp|A6LQH6|ATPB_CLOB8 ATP synthase subunit beta OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=atpD PE=3 SV=1 208 523 3.0E-28
sp|Q4JUK0|ATPB_CORJK ATP synthase subunit beta OS=Corynebacterium jeikeium (strain K411) GN=atpD PE=3 SV=1 208 526 3.0E-28
sp|Q6MGM7|ATPB_BDEBA ATP synthase subunit beta OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=atpD PE=3 SV=1 208 523 3.0E-28
sp|Q9K6H5|ATPB_BACHD ATP synthase subunit beta OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=atpD PE=3 SV=1 211 533 3.0E-28
sp|O34171|FLII_AGRFC Flagellum-specific ATP synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fliI PE=3 SV=1 217 513 3.0E-28
sp|Q5WB78|ATPB_BACSK ATP synthase subunit beta OS=Bacillus clausii (strain KSM-K16) GN=atpD PE=3 SV=1 231 533 3.0E-28
sp|Q07232|ATPB_BUCAP ATP synthase subunit beta OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=atpD PE=3 SV=2 171 523 3.0E-28
sp|Q65DX4|ATPB_BACLD ATP synthase subunit beta OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=atpD PE=3 SV=1 21 533 4.0E-28
sp|O83417|FLII_TREPA Flagellum-specific ATP synthase OS=Treponema pallidum (strain Nichols) GN=fliI PE=3 SV=1 197 457 4.0E-28
sp|C0Z776|ATPB_BREBN ATP synthase subunit beta OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=atpD PE=3 SV=1 231 551 4.0E-28
sp|A6Q4C0|ATPB_NITSB ATP synthase subunit beta OS=Nitratiruptor sp. (strain SB155-2) GN=atpD PE=3 SV=1 201 523 5.0E-28
sp|Q83G91|ATPB_TROWT ATP synthase subunit beta OS=Tropheryma whipplei (strain Twist) GN=atpD PE=3 SV=2 210 526 5.0E-28
sp|Q83HY0|ATPB_TROW8 ATP synthase subunit beta OS=Tropheryma whipplei (strain TW08/27) GN=atpD PE=3 SV=1 210 526 5.0E-28
sp|A5N3H7|ATPB_CLOK5 ATP synthase subunit beta OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=atpD PE=3 SV=1 211 538 6.0E-28
sp|Q6F202|ATPB_MESFL ATP synthase subunit beta OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=atpD PE=3 SV=1 208 526 6.0E-28
sp|Q38WK5|ATPB_LACSS ATP synthase subunit beta OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=atpD PE=3 SV=2 217 524 7.0E-28
sp|Q1WUC6|ATPB_LACS1 ATP synthase subunit beta OS=Lactobacillus salivarius (strain UCC118) GN=atpD PE=3 SV=1 211 533 8.0E-28
sp|Q21CY7|ATPB_RHOPB ATP synthase subunit beta OS=Rhodopseudomonas palustris (strain BisB18) GN=atpD PE=3 SV=1 211 523 9.0E-28
sp|Q180W5|ATPB_PEPD6 ATP synthase subunit beta OS=Peptoclostridium difficile (strain 630) GN=atpD PE=3 SV=1 210 551 9.0E-28
sp|A0JY64|ATPB_ARTS2 ATP synthase subunit beta OS=Arthrobacter sp. (strain FB24) GN=atpD PE=3 SV=1 186 569 9.0E-28
sp|B2G691|ATPB_LACRJ ATP synthase subunit beta OS=Lactobacillus reuteri (strain JCM 1112) GN=atpD PE=3 SV=1 205 533 1.0E-27
sp|A5VIR1|ATPB_LACRD ATP synthase subunit beta OS=Lactobacillus reuteri (strain DSM 20016) GN=atpD PE=3 SV=1 205 533 1.0E-27
sp|B1HM56|ATPB_LYSSC ATP synthase subunit beta OS=Lysinibacillus sphaericus (strain C3-41) GN=atpD PE=3 SV=1 217 533 1.0E-27
sp|Q6NHS9|ATPB_CORDI ATP synthase subunit beta OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=atpD PE=3 SV=1 208 526 1.0E-27
sp|Q74K15|ATPB_LACJO ATP synthase subunit beta OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=atpD PE=3 SV=1 217 535 1.0E-27
sp|Q0AUD3|ATPB_SYNWW ATP synthase subunit beta OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=atpD PE=3 SV=1 210 551 1.0E-27
sp|B3WDL8|ATPB_LACCB ATP synthase subunit beta OS=Lactobacillus casei (strain BL23) GN=atpD PE=3 SV=1 88 524 1.0E-27
sp|Q03A18|ATPB_LACC3 ATP synthase subunit beta OS=Lactobacillus casei (strain ATCC 334) GN=atpD PE=3 SV=1 88 524 1.0E-27
sp|B9MS68|ATPB_CALBD ATP synthase subunit beta OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=atpD PE=3 SV=1 171 523 1.0E-27
sp|Q98EV8|ATPB_RHILO ATP synthase subunit beta OS=Rhizobium loti (strain MAFF303099) GN=atpD PE=3 SV=1 212 523 1.0E-27
sp|Q3SVJ1|ATPB_NITWN ATP synthase subunit beta OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=atpD PE=3 SV=1 211 523 1.0E-27
sp|Q8A9V4|ATPB_BACTN ATP synthase subunit beta OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=atpD PE=3 SV=1 217 550 1.0E-27
sp|P63680|ATPB_STAAW ATP synthase subunit beta OS=Staphylococcus aureus (strain MW2) GN=atpD PE=3 SV=1 211 533 1.0E-27
sp|A8YY70|ATPB_STAAT ATP synthase subunit beta OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=atpD PE=3 SV=1 211 533 1.0E-27
sp|Q6G7K7|ATPB_STAAS ATP synthase subunit beta OS=Staphylococcus aureus (strain MSSA476) GN=atpD PE=3 SV=1 211 533 1.0E-27
sp|Q6GEX2|ATPB_STAAR ATP synthase subunit beta OS=Staphylococcus aureus (strain MRSA252) GN=atpD PE=3 SV=1 211 533 1.0E-27
sp|P99112|ATPB_STAAN ATP synthase subunit beta OS=Staphylococcus aureus (strain N315) GN=atpD PE=1 SV=1 211 533 1.0E-27
sp|P63679|ATPB_STAAM ATP synthase subunit beta OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=atpD PE=3 SV=1 211 533 1.0E-27
sp|A6QIU7|ATPB_STAAE ATP synthase subunit beta OS=Staphylococcus aureus (strain Newman) GN=atpD PE=3 SV=1 211 533 1.0E-27
sp|Q5HE97|ATPB_STAAC ATP synthase subunit beta OS=Staphylococcus aureus (strain COL) GN=atpD PE=3 SV=1 211 533 1.0E-27
sp|Q2YUK1|ATPB_STAAB ATP synthase subunit beta OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=atpD PE=3 SV=1 211 533 1.0E-27
sp|A5IUP8|ATPB_STAA9 ATP synthase subunit beta OS=Staphylococcus aureus (strain JH9) GN=atpD PE=3 SV=1 211 533 1.0E-27
sp|Q2FWF0|ATPB_STAA8 ATP synthase subunit beta OS=Staphylococcus aureus (strain NCTC 8325) GN=atpD PE=3 SV=1 211 533 1.0E-27
sp|Q2FF24|ATPB_STAA3 ATP synthase subunit beta OS=Staphylococcus aureus (strain USA300) GN=atpD PE=3 SV=1 211 533 1.0E-27
sp|A6U3I8|ATPB_STAA2 ATP synthase subunit beta OS=Staphylococcus aureus (strain JH1) GN=atpD PE=3 SV=1 211 533 1.0E-27
sp|A7X4U3|ATPB_STAA1 ATP synthase subunit beta OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=atpD PE=3 SV=1 211 533 1.0E-27
sp|Q5HX59|ATPB_CAMJR ATP synthase subunit beta OS=Campylobacter jejuni (strain RM1221) GN=atpD PE=3 SV=1 208 523 1.0E-27
sp|A1VXJ0|ATPB_CAMJJ ATP synthase subunit beta OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=atpD PE=3 SV=1 208 523 1.0E-27
sp|Q0PC30|ATPB_CAMJE ATP synthase subunit beta OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=atpD PE=3 SV=1 208 523 1.0E-27
sp|A8FJR2|ATPB_CAMJ8 ATP synthase subunit beta OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=atpD PE=3 SV=1 208 523 1.0E-27
sp|A1WZT1|ATPB_HALHL ATP synthase subunit beta OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=atpD PE=3 SV=1 208 523 2.0E-27
sp|P22478|ATPB_BACPE ATP synthase subunit beta OS=Bacillus pseudofirmus (strain OF4) GN=atpD PE=3 SV=2 211 533 2.0E-27
sp|Q88UU3|ATPB_LACPL ATP synthase subunit beta OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=atpD PE=3 SV=1 191 526 2.0E-27
sp|A0RR26|ATPB_CAMFF ATP synthase subunit beta OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=atpD PE=3 SV=1 208 523 2.0E-27
sp|Q03EL4|ATPB_PEDPA ATP synthase subunit beta OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=atpD PE=3 SV=1 191 533 2.0E-27
sp|Q3A083|ATPB2_PELCD ATP synthase subunit beta 2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=atpD2 PE=3 SV=1 201 507 2.0E-27
sp|Q8RGE2|ATPB_FUSNN ATP synthase subunit beta OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=atpD PE=3 SV=1 210 564 2.0E-27
sp|Q11DD5|ATPB_CHESB ATP synthase subunit beta OS=Chelativorans sp. (strain BNC1) GN=atpD PE=3 SV=1 212 523 2.0E-27
sp|Q042L5|ATPB_LACGA ATP synthase subunit beta OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=atpD PE=3 SV=1 217 546 2.0E-27
sp|Q5PAN2|ATPB_ANAMM ATP synthase subunit beta OS=Anaplasma marginale (strain St. Maries) GN=atpD PE=3 SV=1 159 523 2.0E-27
sp|B6JD09|ATPB_OLICO ATP synthase subunit beta OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=atpD PE=3 SV=1 219 523 3.0E-27
sp|B1W0A3|ATPB_STRGG ATP synthase subunit beta OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=atpD PE=3 SV=1 104 527 3.0E-27
sp|P43451|ATPB_ENTHA ATP synthase subunit beta OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=atpD PE=3 SV=1 217 533 3.0E-27
sp|Q4L7Y4|ATPB_STAHJ ATP synthase subunit beta OS=Staphylococcus haemolyticus (strain JCSC1435) GN=atpD PE=3 SV=1 211 533 3.0E-27
sp|Q7VQV6|ATPB_BLOFL ATP synthase subunit beta OS=Blochmannia floridanus GN=atpD PE=3 SV=1 207 510 3.0E-27
sp|Q927W4|ATPB2_LISIN ATP synthase subunit beta 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=atpD2 PE=3 SV=1 217 533 3.0E-27
sp|Q8CNJ7|ATPB_STAES ATP synthase subunit beta OS=Staphylococcus epidermidis (strain ATCC 12228) GN=atpD PE=3 SV=1 211 533 3.0E-27
sp|Q5HMB9|ATPB_STAEQ ATP synthase subunit beta OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=atpD PE=3 SV=1 211 533 3.0E-27
sp|A4XKX0|ATPB_CALS8 ATP synthase subunit beta OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=atpD PE=3 SV=1 171 523 4.0E-27
sp|Q03QY8|ATPB_LACBA ATP synthase subunit beta OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=atpD PE=3 SV=1 88 533 4.0E-27
sp|A8FIB2|ATPB_BACP2 ATP synthase subunit beta OS=Bacillus pumilus (strain SAFR-032) GN=atpD PE=3 SV=1 182 533 4.0E-27
sp|C4LJL4|ATPB_CORK4 ATP synthase subunit beta OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=atpD PE=3 SV=1 208 526 4.0E-27
sp|Q5FKY0|ATPB_LACAC ATP synthase subunit beta OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=atpD PE=2 SV=1 217 549 4.0E-27
sp|A6TK65|ATPB_ALKMQ ATP synthase subunit beta OS=Alkaliphilus metalliredigens (strain QYMF) GN=atpD PE=3 SV=1 210 523 5.0E-27
sp|A0ALL3|ATPB2_LISW6 ATP synthase subunit beta 2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=atpD2 PE=3 SV=1 217 533 5.0E-27
sp|Q8Y4C1|ATPB2_LISMO ATP synthase subunit beta 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=atpD2 PE=3 SV=1 217 533 5.0E-27
sp|Q71WP9|ATPB2_LISMF ATP synthase subunit beta 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=atpD2 PE=3 SV=1 217 533 5.0E-27
sp|O67828|ATPB_AQUAE ATP synthase subunit beta OS=Aquifex aeolicus (strain VF5) GN=atpD PE=3 SV=1 208 523 6.0E-27
sp|P52607|FLII_BORBU Flagellum-specific ATP synthase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=fliI PE=3 SV=1 217 457 6.0E-27
sp|Q03LX3|ATPB_STRTD ATP synthase subunit beta OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=atpD PE=3 SV=1 182 533 6.0E-27
sp|Q5M104|ATPB_STRT1 ATP synthase subunit beta OS=Streptococcus thermophilus (strain CNRZ 1066) GN=atpD PE=3 SV=1 182 533 6.0E-27
sp|A8YUK1|ATPB_LACH4 ATP synthase subunit beta OS=Lactobacillus helveticus (strain DPC 4571) GN=atpD PE=3 SV=1 217 549 7.0E-27
sp|Q03235|ATPB_PECFR ATP synthase subunit beta OS=Pectinatus frisingensis GN=atpD PE=3 SV=1 210 523 7.0E-27
sp|Q2G5N5|ATPB_NOVAD ATP synthase subunit beta OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atpD PE=3 SV=1 208 523 7.0E-27
sp|P0A301|ATPB_STRLI ATP synthase subunit beta OS=Streptomyces lividans GN=atpD PE=1 SV=2 208 526 7.0E-27
sp|P0A300|ATPB_STRCO ATP synthase subunit beta OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=atpD PE=3 SV=2 208 526 7.0E-27
sp|Q831A5|ATPB_ENTFA ATP synthase subunit beta OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=atpD PE=3 SV=1 217 550 7.0E-27
sp|Q2J3I4|ATPB_RHOP2 ATP synthase subunit beta OS=Rhodopseudomonas palustris (strain HaA2) GN=atpD PE=3 SV=1 211 523 8.0E-27
sp|Q3A946|ATPB_CARHZ ATP synthase subunit beta OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=atpD PE=3 SV=1 210 523 8.0E-27
sp|A8AYG1|ATPB_STRGC ATP synthase subunit beta OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=atpD PE=3 SV=1 208 551 8.0E-27
sp|Q5M5J1|ATPB_STRT2 ATP synthase subunit beta OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=atpD PE=3 SV=1 182 533 8.0E-27
sp|P33253|ATPB_MYCGA ATP synthase subunit beta OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=atpD PE=3 SV=1 228 551 8.0E-27
sp|C1CLK6|ATPB_STRZP ATP synthase subunit beta OS=Streptococcus pneumoniae (strain P1031) GN=atpD PE=3 SV=1 182 533 8.0E-27
sp|C1CF93|ATPB_STRZJ ATP synthase subunit beta OS=Streptococcus pneumoniae (strain JJA) GN=atpD PE=3 SV=1 182 533 8.0E-27
sp|Q8DP44|ATPB_STRR6 ATP synthase subunit beta OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=atpD PE=1 SV=1 182 533 8.0E-27
sp|B2IQX0|ATPB_STRPS ATP synthase subunit beta OS=Streptococcus pneumoniae (strain CGSP14) GN=atpD PE=3 SV=1 182 533 8.0E-27
sp|Q97PT6|ATPB_STRPN ATP synthase subunit beta OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=atpD PE=3 SV=1 182 533 8.0E-27
sp|B8ZLA9|ATPB_STRPJ ATP synthase subunit beta OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=atpD PE=3 SV=1 182 533 8.0E-27
sp|B1ICS9|ATPB_STRPI ATP synthase subunit beta OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=atpD PE=3 SV=1 182 533 8.0E-27
sp|C1C899|ATPB_STRP7 ATP synthase subunit beta OS=Streptococcus pneumoniae (strain 70585) GN=atpD PE=3 SV=1 182 533 8.0E-27
sp|Q04HT9|ATPB_STRP2 ATP synthase subunit beta OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=atpD PE=3 SV=1 182 533 8.0E-27
sp|C1CSC8|ATPB_STRZT ATP synthase subunit beta OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=atpD PE=3 SV=1 182 533 9.0E-27
sp|B9DRT6|ATPB_STRU0 ATP synthase subunit beta OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=atpD PE=3 SV=1 211 533 9.0E-27
sp|B9L7Y7|ATPB_NAUPA ATP synthase subunit beta OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=atpD PE=3 SV=1 210 523 9.0E-27
sp|B9DME3|ATPB_STACT ATP synthase subunit beta OS=Staphylococcus carnosus (strain TM300) GN=atpD PE=3 SV=1 182 533 9.0E-27
sp|Q1AVH9|ATPB_RUBXD ATP synthase subunit beta OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=atpD PE=3 SV=2 210 523 9.0E-27
sp|Q89X74|ATPB_BRADU ATP synthase subunit beta OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=atpD PE=3 SV=1 228 523 9.0E-27
sp|Q1J7F9|ATPB_STRPF ATP synthase subunit beta OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=atpD PE=3 SV=1 130 533 1.0E-26
sp|Q1JHN5|ATPB_STRPD ATP synthase subunit beta OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=atpD PE=3 SV=1 130 533 1.0E-26
sp|Q8P1K5|ATPB_STRP8 ATP synthase subunit beta OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=atpD PE=3 SV=1 130 533 1.0E-26
sp|Q5XCY0|ATPB_STRP6 ATP synthase subunit beta OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=atpD PE=3 SV=1 130 533 1.0E-26
sp|A3CM14|ATPB_STRSV ATP synthase subunit beta OS=Streptococcus sanguinis (strain SK36) GN=atpD PE=3 SV=1 208 551 1.0E-26
sp|Q07UZ5|ATPB_RHOP5 ATP synthase subunit beta OS=Rhodopseudomonas palustris (strain BisA53) GN=atpD PE=3 SV=1 211 523 1.0E-26
sp|P0A1B9|SPAL_SALTY Probable ATP synthase SpaL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=spaL PE=1 SV=1 205 496 1.0E-26
sp|P0A1C0|SPAL_SALTI Probable ATP synthase SpaL OS=Salmonella typhi GN=spaL PE=3 SV=1 205 496 1.0E-26
sp|A8MJV9|ATPB_ALKOO ATP synthase subunit beta OS=Alkaliphilus oremlandii (strain OhILAs) GN=atpD PE=3 SV=1 211 551 1.0E-26
sp|Q2RFX9|ATPB_MOOTA ATP synthase subunit beta OS=Moorella thermoacetica (strain ATCC 39073) GN=atpD PE=1 SV=1 208 523 1.0E-26
sp|A2RFC2|ATPB_STRPG ATP synthase subunit beta OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=atpD PE=3 SV=1 130 533 1.0E-26
sp|P0DA05|ATPB_STRPQ ATP synthase subunit beta OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=atpD PE=3 SV=1 130 533 1.0E-26
sp|Q48UD3|ATPB_STRPM ATP synthase subunit beta OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=atpD PE=3 SV=1 130 533 1.0E-26
sp|Q1JMI9|ATPB_STRPC ATP synthase subunit beta OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=atpD PE=3 SV=1 130 533 1.0E-26
sp|Q1JCL3|ATPB_STRPB ATP synthase subunit beta OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=atpD PE=3 SV=1 130 533 1.0E-26
sp|P0DA04|ATPB_STRP3 ATP synthase subunit beta OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=atpD PE=3 SV=1 130 533 1.0E-26
sp|Q9A0I7|ATPB_STRP1 ATP synthase subunit beta OS=Streptococcus pyogenes serotype M1 GN=atpD PE=3 SV=1 130 533 1.0E-26
sp|A0M791|ATPB_GRAFK ATP synthase subunit beta OS=Gramella forsetii (strain KT0803) GN=atpD PE=3 SV=1 210 523 1.0E-26
sp|A4VVJ9|ATPB_STRSY ATP synthase subunit beta OS=Streptococcus suis (strain 05ZYH33) GN=atpD PE=3 SV=2 211 550 1.0E-26
sp|A4W1V7|ATPB_STRS2 ATP synthase subunit beta OS=Streptococcus suis (strain 98HAH33) GN=atpD PE=3 SV=2 211 550 1.0E-26
sp|Q6NDD2|ATPB_RHOPA ATP synthase subunit beta OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=atpD PE=3 SV=1 228 523 1.0E-26
sp|C0R5I6|ATPB_WOLWR ATP synthase subunit beta OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=atpD PE=3 SV=1 213 523 1.0E-26
sp|Q03234|ATPB_LACCA ATP synthase subunit beta OS=Lactobacillus casei GN=atpD PE=3 SV=1 231 524 2.0E-26
sp|A8EV70|ATPB_ARCB4 ATP synthase subunit beta OS=Arcobacter butzleri (strain RM4018) GN=atpD PE=3 SV=1 208 523 2.0E-26
sp|Q49Z50|ATPB_STAS1 ATP synthase subunit beta OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=atpD PE=3 SV=1 211 550 2.0E-26
sp|B5E670|ATPB_STRP4 ATP synthase subunit beta OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=atpD PE=3 SV=1 182 524 2.0E-26
sp|P50002|ATPB_ACEWD ATP synthase subunit beta, sodium ion specific OS=Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655) GN=atpD PE=1 SV=3 210 523 2.0E-26
sp|A0LSL6|ATPB_ACIC1 ATP synthase subunit beta OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=atpD PE=3 SV=1 206 526 2.0E-26
sp|B5YI24|ATPB_THEYD ATP synthase subunit beta OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=atpD PE=3 SV=1 210 523 2.0E-26
sp|B8FZ34|ATPB_DESHD ATP synthase subunit beta OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=atpD PE=3 SV=1 200 555 2.0E-26
sp|Q24MP1|ATPB_DESHY ATP synthase subunit beta OS=Desulfitobacterium hafniense (strain Y51) GN=atpD PE=3 SV=2 200 555 2.0E-26
sp|Q82J84|ATPB_STRAW ATP synthase subunit beta OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=atpD PE=3 SV=1 104 526 2.0E-26
sp|P42469|ATPB_STIAU ATP synthase subunit beta OS=Stigmatella aurantiaca GN=atpD PE=3 SV=1 208 523 2.0E-26
sp|B8J439|ATPB_DESDA ATP synthase subunit beta OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=atpD PE=3 SV=1 210 523 2.0E-26
sp|B6YQC5|ATPB_AZOPC ATP synthase subunit beta OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=atpD PE=3 SV=1 231 523 2.0E-26
sp|Q1QQS8|ATPB_NITHX ATP synthase subunit beta OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=atpD PE=3 SV=1 228 523 2.0E-26
sp|Q02BU1|ATPB_SOLUE ATP synthase subunit beta OS=Solibacter usitatus (strain Ellin6076) GN=atpD PE=3 SV=1 208 523 2.0E-26
sp|Q3ZZT7|ATPB_DEHMC ATP synthase subunit beta OS=Dehalococcoides mccartyi (strain CBDB1) GN=atpD PE=3 SV=1 130 523 2.0E-26
sp|A5FRQ5|ATPB_DEHMB ATP synthase subunit beta OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=atpD PE=3 SV=1 130 523 2.0E-26
sp|A6L8P2|ATPB_PARD8 ATP synthase subunit beta OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=atpD PE=3 SV=1 209 535 2.0E-26
sp|O50292|ATPB_AQUPY ATP synthase subunit beta OS=Aquifex pyrophilus GN=atpD PE=3 SV=1 208 523 2.0E-26
sp|Q13DP2|ATPB_RHOPS ATP synthase subunit beta OS=Rhodopseudomonas palustris (strain BisB5) GN=atpD PE=3 SV=1 211 523 2.0E-26
sp|P26465|FLII_SALTY Flagellum-specific ATP synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fliI PE=1 SV=1 231 530 2.0E-26
sp|A7Z9Q0|ATPB_BACMF ATP synthase subunit beta OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=atpD PE=3 SV=1 208 533 3.0E-26
sp|A4YKE0|ATPB_BRASO ATP synthase subunit beta OS=Bradyrhizobium sp. (strain ORS278) GN=atpD PE=3 SV=1 228 523 3.0E-26
sp|A5E950|ATPB1_BRASB ATP synthase subunit beta 1 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=atpD1 PE=3 SV=1 228 523 3.0E-26
sp|A7I177|ATPB_CAMHC ATP synthase subunit beta OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=atpD PE=3 SV=1 210 523 3.0E-26
sp|Q30QQ1|ATPB_SULDN ATP synthase subunit beta OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=atpD PE=3 SV=1 202 523 3.0E-26
sp|B1MW85|ATPB_LEUCK ATP synthase subunit beta OS=Leuconostoc citreum (strain KM20) GN=atpD PE=3 SV=1 217 535 3.0E-26
sp|A8L3W5|ATPB_FRASN ATP synthase subunit beta OS=Frankia sp. (strain EAN1pec) GN=atpD PE=3 SV=1 210 523 4.0E-26
sp|P95789|ATPB_STRMU ATP synthase subunit beta OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=atpD PE=3 SV=3 208 533 4.0E-26
sp|Q2NQ86|ATPB_SODGM ATP synthase subunit beta OS=Sodalis glossinidius (strain morsitans) GN=atpD PE=3 SV=1 208 523 4.0E-26
sp|A5FZ54|ATPB_ACICJ ATP synthase subunit beta OS=Acidiphilium cryptum (strain JF-5) GN=atpD PE=3 SV=1 205 523 5.0E-26
sp|A6QB59|ATPB_SULNB ATP synthase subunit beta OS=Sulfurovum sp. (strain NBC37-1) GN=atpD PE=3 SV=1 210 523 5.0E-26
sp|Q73IG3|ATPB_WOLPM ATP synthase subunit beta OS=Wolbachia pipientis wMel GN=atpD PE=3 SV=1 213 523 5.0E-26
sp|A7IH31|ATPB_XANP2 ATP synthase subunit beta OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=atpD PE=3 SV=1 212 523 6.0E-26
sp|P29707|ATPB_PROMO ATP synthase subunit beta, sodium ion specific OS=Propionigenium modestum GN=atpD PE=1 SV=2 211 522 6.0E-26
sp|A4J999|ATPB_DESRM ATP synthase subunit beta OS=Desulfotomaculum reducens (strain MI-1) GN=atpD PE=3 SV=1 130 523 6.0E-26
sp|Q39ZU1|ATPB3_PELCD ATP synthase subunit beta 3 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=atpD3 PE=3 SV=1 154 523 6.0E-26
sp|A8G7M8|ATPB_SERP5 ATP synthase subunit beta OS=Serratia proteamaculans (strain 568) GN=atpD PE=3 SV=1 208 523 7.0E-26
sp|B3CN17|ATPB_WOLPP ATP synthase subunit beta OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=atpD PE=3 SV=1 213 523 7.0E-26
sp|A9F3R4|ATPB_SORC5 ATP synthase subunit beta OS=Sorangium cellulosum (strain So ce56) GN=atpD PE=3 SV=1 213 523 7.0E-26
sp|Q1GAW5|ATPB_LACDA ATP synthase subunit beta OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=atpD PE=3 SV=1 231 549 7.0E-26
sp|Q04G20|ATPB_OENOB ATP synthase subunit beta OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=atpD PE=3 SV=2 210 551 7.0E-26
sp|Q3A605|ATPB1_PELCD ATP synthase subunit beta 1 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=atpD1 PE=3 SV=1 154 523 7.0E-26
sp|A5EBX1|ATPB2_BRASB ATP synthase subunit beta 2 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=atpD2 PE=3 SV=1 211 507 7.0E-26
sp|C0MH17|ATPB_STRS7 ATP synthase subunit beta OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=atpD PE=3 SV=1 211 550 7.0E-26
sp|B5XKQ1|ATPB_STRPZ ATP synthase subunit beta OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=atpD PE=3 SV=1 130 533 7.0E-26
sp|B4U2E1|ATPB_STREM ATP synthase subunit beta OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=atpD PE=3 SV=1 211 550 7.0E-26
sp|C0M720|ATPB_STRE4 ATP synthase subunit beta OS=Streptococcus equi subsp. equi (strain 4047) GN=atpD PE=3 SV=1 211 550 7.0E-26
sp|A5V3X5|ATPB_SPHWW ATP synthase subunit beta OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=atpD PE=3 SV=1 208 523 7.0E-26
sp|A7HT52|ATPB_PARL1 ATP synthase subunit beta OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=atpD PE=3 SV=1 226 523 7.0E-26
sp|B0THN2|ATPB_HELMI ATP synthase subunit beta OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=atpD PE=3 SV=1 208 523 7.0E-26
sp|Q1GQS5|ATPB_SPHAL ATP synthase subunit beta OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=atpD PE=3 SV=1 228 546 7.0E-26
sp|Q04BA3|ATPB_LACDB ATP synthase subunit beta OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=atpD PE=3 SV=1 231 549 8.0E-26
sp|Q3Z8Z2|ATPB_DEHM1 ATP synthase subunit beta OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=atpD PE=3 SV=1 130 523 8.0E-26
sp|A8ZUA1|ATPB_DESOH ATP synthase subunit beta OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=atpD PE=3 SV=1 208 523 8.0E-26
sp|Q50331|ATPB_MYCPN ATP synthase subunit beta OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=atpD PE=3 SV=1 201 523 9.0E-26
sp|Q7UFB5|ATPB_RHOBA ATP synthase subunit beta OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=atpD PE=3 SV=1 210 523 9.0E-26
sp|A5CYE2|ATPB_PELTS ATP synthase subunit beta OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=atpD PE=3 SV=1 208 551 9.0E-26
sp|Q2JX57|ATPB_SYNJA ATP synthase subunit beta OS=Synechococcus sp. (strain JA-3-3Ab) GN=atpD PE=3 SV=1 205 523 9.0E-26
sp|Q67TB7|ATPB_SYMTH ATP synthase subunit beta OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=atpD PE=3 SV=1 217 523 1.0E-25
sp|Q0QEP2|ATPB_MESAU ATP synthase subunit beta, mitochondrial (Fragment) OS=Mesocricetus auratus GN=ATP5B PE=1 SV=1 208 523 1.0E-25
sp|Q2J6N3|ATPB_FRASC ATP synthase subunit beta OS=Frankia sp. (strain CcI3) GN=atpD PE=3 SV=1 210 523 1.0E-25
sp|Q5WSG8|ATPB_LEGPL ATP synthase subunit beta OS=Legionella pneumophila (strain Lens) GN=atpD PE=3 SV=1 208 523 1.0E-25
sp|Q5ZRA1|ATPB_LEGPH ATP synthase subunit beta OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=atpD PE=3 SV=1 208 523 1.0E-25
sp|A5III3|ATPB_LEGPC ATP synthase subunit beta OS=Legionella pneumophila (strain Corby) GN=atpD PE=3 SV=1 208 523 1.0E-25
sp|Q5X0P3|ATPB_LEGPA ATP synthase subunit beta OS=Legionella pneumophila (strain Paris) GN=atpD PE=3 SV=1 208 523 1.0E-25
sp|P47639|ATPB_MYCGE ATP synthase subunit beta OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=atpD PE=3 SV=2 228 523 1.0E-25
sp|P23704|ATPB_NEUCR ATP synthase subunit beta, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp-2 PE=2 SV=1 205 523 1.0E-25
sp|P13357|ATPB_CELLY ATP synthase subunit beta OS=Cellulophaga lytica GN=atpD PE=3 SV=1 210 523 1.0E-25
sp|Q9PTY0|ATPB_CYPCA ATP synthase subunit beta, mitochondrial OS=Cyprinus carpio GN=atp5b PE=2 SV=1 208 523 1.0E-25
sp|A8HS10|ATPB_AZOC5 ATP synthase subunit beta OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=atpD PE=3 SV=1 228 523 1.0E-25
sp|P46561|ATPB_CAEEL ATP synthase subunit beta, mitochondrial OS=Caenorhabditis elegans GN=atp-2 PE=1 SV=2 228 523 1.0E-25
sp|Q03V29|ATPB_LEUMM ATP synthase subunit beta OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=atpD PE=3 SV=1 231 535 2.0E-25
sp|P22068|ATPB_SCHPO ATP synthase subunit beta, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp2 PE=1 SV=1 211 523 2.0E-25
sp|Q4FP38|ATPB_PELUB ATP synthase subunit beta OS=Pelagibacter ubique (strain HTCC1062) GN=atpD PE=3 SV=1 201 523 2.0E-25
sp|A1SS55|ATPB1_PSYIN ATP synthase subunit beta 1 OS=Psychromonas ingrahamii (strain 37) GN=atpD1 PE=3 SV=1 213 522 2.0E-25
sp|P37809|ATPB_BACSU ATP synthase subunit beta OS=Bacillus subtilis (strain 168) GN=atpD PE=1 SV=1 211 533 2.0E-25
sp|Q3B406|ATPB2_CHLL7 ATP synthase subunit beta 2 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=atpD2 PE=3 SV=1 213 535 2.0E-25
sp|Q8EWY8|ATPB_MYCPE ATP synthase subunit beta OS=Mycoplasma penetrans (strain HF-2) GN=atpD PE=3 SV=1 201 523 2.0E-25
sp|P13356|ATPB_BACFR ATP synthase subunit beta OS=Bacteroides fragilis (strain YCH46) GN=atpD PE=3 SV=2 217 535 2.0E-25
sp|Q5LD89|ATPB_BACFN ATP synthase subunit beta OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=atpD PE=3 SV=1 217 535 2.0E-25
sp|Q5Z0Y1|ATPB_NOCFA ATP synthase subunit beta OS=Nocardia farcinica (strain IFM 10152) GN=atpD PE=3 SV=1 208 524 3.0E-25
sp|P25075|ATPB_BACFI ATP synthase subunit beta OS=Bacillus firmus GN=atpD PE=3 SV=1 211 533 3.0E-25
sp|Q494C3|ATPB_BLOPB ATP synthase subunit beta OS=Blochmannia pennsylvanicus (strain BPEN) GN=atpD PE=3 SV=1 208 510 3.0E-25
sp|P38482|ATPBM_CHLRE ATP synthase subunit beta, mitochondrial OS=Chlamydomonas reinhardtii GN=ATP2 PE=1 SV=1 154 523 3.0E-25
sp|Q0BQE8|ATPB_GRABC ATP synthase subunit beta OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=atpD PE=3 SV=1 208 523 3.0E-25
sp|A5FLS1|ATPB_FLAJ1 ATP synthase subunit beta OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=atpD PE=3 SV=1 208 523 4.0E-25
sp|C1F3N6|ATPB_ACIC5 ATP synthase subunit beta OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=atpD PE=3 SV=1 220 574 4.0E-25
sp|A9H9A8|ATPB_GLUDA ATP synthase subunit beta OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=atpD PE=3 SV=1 208 523 4.0E-25
sp|P56480|ATPB_MOUSE ATP synthase subunit beta, mitochondrial OS=Mus musculus GN=Atp5b PE=1 SV=2 208 523 4.0E-25
sp|B8GRB8|ATPB_THISH ATP synthase subunit beta OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=atpD PE=3 SV=1 208 523 4.0E-25
sp|B1JRN2|ATPB_YERPY ATP synthase subunit beta OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=atpD PE=3 SV=1 208 523 4.0E-25
sp|Q663Q8|ATPB_YERPS ATP synthase subunit beta OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=atpD PE=3 SV=1 208 523 4.0E-25
sp|A4TSJ3|ATPB_YERPP ATP synthase subunit beta OS=Yersinia pestis (strain Pestoides F) GN=atpD PE=3 SV=1 208 523 4.0E-25
sp|Q1CCH5|ATPB_YERPN ATP synthase subunit beta OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=atpD PE=3 SV=1 208 523 4.0E-25
sp|A9R5T9|ATPB_YERPG ATP synthase subunit beta OS=Yersinia pestis bv. Antiqua (strain Angola) GN=atpD PE=3 SV=1 208 523 4.0E-25
sp|Q7CFM8|ATPB_YERPE ATP synthase subunit beta OS=Yersinia pestis GN=atpD PE=3 SV=1 208 523 4.0E-25
sp|B2K847|ATPB_YERPB ATP synthase subunit beta OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=atpD PE=3 SV=1 208 523 4.0E-25
sp|Q1C095|ATPB_YERPA ATP synthase subunit beta OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=atpD PE=3 SV=1 208 523 4.0E-25
sp|A7FPE0|ATPB_YERP3 ATP synthase subunit beta OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=atpD PE=3 SV=1 208 523 4.0E-25
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:1902600 proton transmembrane transport Yes
GO:0046034 ATP metabolic process Yes
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0006811 ion transport No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006810 transport No
GO:0009117 nucleotide metabolic process No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0006807 nitrogen compound metabolic process No
GO:0017144 drug metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0046483 heterocycle metabolic process No
GO:0008144 drug binding No
GO:0006163 purine nucleotide metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0098662 inorganic cation transmembrane transport No
GO:0003674 molecular_function No
GO:0034220 ion transmembrane transport No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009141 nucleoside triphosphate metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0019693 ribose phosphate metabolic process No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0009150 purine ribonucleotide metabolic process No
GO:0043168 anion binding No
GO:0051234 establishment of localization No
GO:0097367 carbohydrate derivative binding No
GO:0098655 cation transmembrane transport No
GO:1901135 carbohydrate derivative metabolic process No
GO:0017076 purine nucleotide binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0072521 purine-containing compound metabolic process No
GO:0015672 monovalent inorganic cation transport No
GO:0006812 cation transport No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0051179 localization No
GO:0055085 transmembrane transport No
GO:0030554 adenyl nucleotide binding No
GO:0019637 organophosphate metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0098660 inorganic ion transmembrane transport No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6438
MAPKAQKANNANGDGDASHHGKIYSISGPVIVAEDMIGVAMYEMVKVGHESLVGEVIRINSDQATIQVYEETAGV
KVGDPVARTGKPLSVELGPGLLNGIYDGIQRPLEEISNVAKSIYIPRGISVPALDRKKKWEFTPTMKVGDHIAGG
DVWGTVFENSFISTHRILFPPRARGTITRIAPKGEYTVEEKILQVDFDGTKTEYPMMQSWPVRVPRPSTEKLAAD
QPFVVGQRVLDALFPGVQGGTIAIPGAFGCGKTVISQSVSKFSNSDVIVYVGCGERGNEMAEVLKDFPELTIEVD
GRKEPIMKRTTLIANTSNMPVAAREASIYTGITVAEYFRDQGLDVAMMADSSSRWAEALREISGRLGEMPADQGF
PAYLSAKLASFYERAGKIQALGSPEREGSVSIVGAVSPPGGDFSDPVTSSTLSIVQVFWGLDKKLAQRKHFPSIN
TSLSYSKYTTILDRYYEKEYPDFPKLRDRIKQLLSDSEELDQVVQLVGKSALSDPDKITLDIAGLIKEDFLQQNG
YSDYDQFCPIWKTEWMMKLMVGFHDESQKAIAQGQSWAKVREATSDLQAKLRQLKFELPTDGEEAVTKKYESIHQ
QMMDKFASVMDE*
Coding >Hirsu2|6438
ATGGCGCCCAAAGCGCAGAAAGCGAACAACGCCAATGGCGATGGCGATGCCTCGCACCATGGCAAAATCTATTCC
ATCTCCGGCCCCGTCATTGTGGCCGAAGACATGATTGGTGTTGCCATGTACGAAATGGTCAAAGTCGGCCACGAG
AGCCTCGTCGGCGAGGTCATCCGAATCAACAGTGACCAGGCCACCATTCAAGTCTACGAGGAAACTGCCGGTGTC
AAGGTCGGCGATCCCGTTGCGCGAACCGGCAAGCCCCTGTCCGTCGAACTCGGCCCCGGCCTGCTCAACGGCATC
TACGACGGCATCCAACGACCGCTCGAGGAGATCTCCAACGTTGCCAAGAGCATCTACATCCCTCGCGGCATTTCC
GTCCCCGCCCTCGACCGCAAGAAGAAGTGGGAGTTCACGCCGACCATGAAGGTGGGCGACCACATCGCCGGCGGC
GACGTCTGGGGTACCGTCTTCGAAAACTCCTTCATCTCCACCCACCGGATCCTCTTCCCTCCCCGCGCCCGCGGC
ACCATCACTCGCATCGCCCCCAAGGGTGAGTACACGGTCGAGGAAAAAATTCTTCAAGTCGACTTCGACGGCACC
AAGACCGAGTACCCGATGATGCAGTCGTGGCCCGTCCGAGTCCCTCGACCGTCCACCGAGAAGCTCGCCGCCGAC
CAGCCCTTTGTCGTCGGCCAGCGCGTGCTGGACGCTCTGTTCCCGGGTGTCCAGGGCGGCACCATTGCCATCCCC
GGCGCCTTTGGCTGCGGCAAGACCGTCATCAGCCAGTCCGTGTCCAAGTTCTCCAACAGCGACGTCATCGTCTAC
GTCGGCTGCGGCGAGCGCGGCAACGAGATGGCCGAGGTGCTCAAGGACTTCCCCGAGCTCACCATCGAGGTCGAT
GGCCGCAAGGAGCCCATCATGAAGCGGACGACGCTCATCGCCAACACGTCCAACATGCCCGTCGCCGCGCGCGAG
GCCTCCATCTACACGGGAATTACGGTTGCCGAGTATTTCCGCGACCAGGGCCTCGACGTGGCCATGATGGCCGAC
TCGTCGTCGCGCTGGGCCGAGGCCCTCCGAGAGATCTCGGGTCGGCTGGGAGAGATGCCTGCCGACCAGGGCTTC
CCGGCCTACCTCAGCGCCAAGCTGGCCTCCTTCTACGAGCGAGCCGGCAAGATCCAGGCTCTGGGCTCGCCCGAG
CGCGAGGGCAGCGTCAGCATCGTCGGCGCCGTCAGCCCCCCCGGCGGCGACTTCTCGGACCCGGTCACCAGCTCG
ACGCTCAGCATCGTCCAGGTCTTTTGGGGCCTCGACAAGAAGCTCGCCCAGCGGAAGCACTTCCCGTCGATCAAC
ACGAGCCTGTCGTACAGCAAGTACACGACGATCCTGGACAGGTACTACGAGAAGGAGTACCCCGACTTCCCCAAG
CTGCGCGACCGGATCAAGCAGCTGCTGTCGGACTCGGAGGAGCTGGACCAGGTGGTGCAGCTGGTGGGCAAGAGC
GCGCTCTCGGACCCCGACAAGATCACGCTCGACATCGCCGGGCTGATCAAGGAGGACTTTTTGCAGCAGAACGGC
TACTCGGACTACGACCAGTTCTGTCCGATCTGGAAGACGGAGTGGATGATGAAGCTCATGGTCGGCTTCCACGAC
GAATCGCAAAAGGCCATCGCCCAGGGCCAGAGCTGGGCCAAGGTGCGCGAGGCCACGAGCGACCTGCAAGCCAAG
CTGAGGCAGCTCAAGTTTGAGCTGCCGACGGACGGCGAGGAGGCCGTCACCAAGAAGTACGAGAGCATCCACCAG
CAGATGATGGACAAGTTTGCGTCGGTCATGGACGAGTAA
Transcript >Hirsu2|6438
ATGGCGCCCAAAGCGCAGAAAGCGAACAACGCCAATGGCGATGGCGATGCCTCGCACCATGGCAAAATCTATTCC
ATCTCCGGCCCCGTCATTGTGGCCGAAGACATGATTGGTGTTGCCATGTACGAAATGGTCAAAGTCGGCCACGAG
AGCCTCGTCGGCGAGGTCATCCGAATCAACAGTGACCAGGCCACCATTCAAGTCTACGAGGAAACTGCCGGTGTC
AAGGTCGGCGATCCCGTTGCGCGAACCGGCAAGCCCCTGTCCGTCGAACTCGGCCCCGGCCTGCTCAACGGCATC
TACGACGGCATCCAACGACCGCTCGAGGAGATCTCCAACGTTGCCAAGAGCATCTACATCCCTCGCGGCATTTCC
GTCCCCGCCCTCGACCGCAAGAAGAAGTGGGAGTTCACGCCGACCATGAAGGTGGGCGACCACATCGCCGGCGGC
GACGTCTGGGGTACCGTCTTCGAAAACTCCTTCATCTCCACCCACCGGATCCTCTTCCCTCCCCGCGCCCGCGGC
ACCATCACTCGCATCGCCCCCAAGGGTGAGTACACGGTCGAGGAAAAAATTCTTCAAGTCGACTTCGACGGCACC
AAGACCGAGTACCCGATGATGCAGTCGTGGCCCGTCCGAGTCCCTCGACCGTCCACCGAGAAGCTCGCCGCCGAC
CAGCCCTTTGTCGTCGGCCAGCGCGTGCTGGACGCTCTGTTCCCGGGTGTCCAGGGCGGCACCATTGCCATCCCC
GGCGCCTTTGGCTGCGGCAAGACCGTCATCAGCCAGTCCGTGTCCAAGTTCTCCAACAGCGACGTCATCGTCTAC
GTCGGCTGCGGCGAGCGCGGCAACGAGATGGCCGAGGTGCTCAAGGACTTCCCCGAGCTCACCATCGAGGTCGAT
GGCCGCAAGGAGCCCATCATGAAGCGGACGACGCTCATCGCCAACACGTCCAACATGCCCGTCGCCGCGCGCGAG
GCCTCCATCTACACGGGAATTACGGTTGCCGAGTATTTCCGCGACCAGGGCCTCGACGTGGCCATGATGGCCGAC
TCGTCGTCGCGCTGGGCCGAGGCCCTCCGAGAGATCTCGGGTCGGCTGGGAGAGATGCCTGCCGACCAGGGCTTC
CCGGCCTACCTCAGCGCCAAGCTGGCCTCCTTCTACGAGCGAGCCGGCAAGATCCAGGCTCTGGGCTCGCCCGAG
CGCGAGGGCAGCGTCAGCATCGTCGGCGCCGTCAGCCCCCCCGGCGGCGACTTCTCGGACCCGGTCACCAGCTCG
ACGCTCAGCATCGTCCAGGTCTTTTGGGGCCTCGACAAGAAGCTCGCCCAGCGGAAGCACTTCCCGTCGATCAAC
ACGAGCCTGTCGTACAGCAAGTACACGACGATCCTGGACAGGTACTACGAGAAGGAGTACCCCGACTTCCCCAAG
CTGCGCGACCGGATCAAGCAGCTGCTGTCGGACTCGGAGGAGCTGGACCAGGTGGTGCAGCTGGTGGGCAAGAGC
GCGCTCTCGGACCCCGACAAGATCACGCTCGACATCGCCGGGCTGATCAAGGAGGACTTTTTGCAGCAGAACGGC
TACTCGGACTACGACCAGTTCTGTCCGATCTGGAAGACGGAGTGGATGATGAAGCTCATGGTCGGCTTCCACGAC
GAATCGCAAAAGGCCATCGCCCAGGGCCAGAGCTGGGCCAAGGTGCGCGAGGCCACGAGCGACCTGCAAGCCAAG
CTGAGGCAGCTCAAGTTTGAGCTGCCGACGGACGGCGAGGAGGCCGTCACCAAGAAGTACGAGAGCATCCACCAG
CAGATGATGGACAAGTTTGCGTCGGTCATGGACGAGTAA
Gene >Hirsu2|6438
ATGGCGCCCGTGCGTGTCTCCCACTGGCTTTGCAAGCCCACGCCCGCCCGAGACGCGGCTCTGCTGCCCCCCACG
CGCCGCCGGCCAGCCAAGCTAATTTGCCACCATCACGCAGAAAGCGCAGAAAGCGAACAACGCCAATGGCGATGG
CGATGCCTCGCACCATGGTACGGAACCCCGAGCTGGCCCACTAGCTCTATCGAGACTCGATGACTGACAGACTCG
CGCAGGCAAAATCTATTCCATCTCCGGGTGAGCTCCAGACCGCGCTTTTGGCCTTTGCCGACGTGCCTCATCGCG
CGGCCGTCATGCTGACTCGCCGCAGCCCCGTCATTGTGGCCGAAGACATGATTGGTGTTGCCATGTACGAAATGG
TACGCAAGATAACGTTGCCCGCGAGCCTGTCCGCGCCTCCCTAACCATTTGTCGGCGGCTGGCAGGTCAAAGTCG
GCCACGAGAGCCTCGTCGGCGAGGTCATCCGAATCAACAGTGACCAGGCCACCATTCAAGTCTACGAGGAAACTG
GTGCGGCCCAGAGATACCCTTCCTGACTTCTGCTCACGCGGTGTCCGAGACTAACGCCATCCTCGCCAGCCGGTG
TCAAGGTCGGCGATCCCGTTGCGCGAACCGGCAAGCCCCTGTCCGTCGAACTCGGCCCCGGCCTGCTCAACGGCA
TCTACGACGGCATCCAACGACCGCTCGAGGAGATCTCCAACGTTGCCAAGAGCATCTACATCCCTCGCGGCATTT
CCGTCCCCGCCCTCGACCGCAAGAAGAAGTGGGAGTTCACGCCGACCATGAAGGTGGGCGACCACATCGCCGGCG
GCGACGTCTGGGGTACCGTCTTCGAAAACTCCTTCATCTCCACCCACCGGATCCTCTTCCCTCCCCGCGCCCGCG
GCACCATCACTCGCATCGCCCCCAAGGGTGAGTACACGGTCGAGGAAAAAATTCTTCAAGTCGACTTCGACGGCA
CCAAGACCGAGTACCCGATGATGCAGTCGTGGCCCGTCCGAGTCCCTCGACCGTCCACCGAGAAGCTCGCCGCCG
ACCAGCCCTTTGTCGTCGGCCAGCGCGTGCTGGACGCTCTGTTCCCGGGTGTCCAGGGCGGCACCATTGCCATCC
CCGGCGCCTTTGGCTGCGGCAAGACCGTCATCAGCCAGTCCGTGTCCAAGTTCTCCAACAGCGACGTCATCGTCT
ACGTCGGCTGCGGCGAGCGCGGCAACGAGATGGCCGAGGTGCTCAAGGACTTCCCCGAGCTCACCATCGAGGTCG
ATGGCCGCAAGGAGCCCATCATGAAGCGGACGACGCTCATCGCCAACACGTCCAACATGCCCGTCGCCGCGCGCG
AGGCCTCCATCTACACGGGAATTACGGTTGCCGAGTATTTCCGCGACCAGGGCCTCGACGTGGCCATGATGGCCG
ACTCGTCGTCGCGCTGGGCCGAGGCCCTCCGAGAGATCTCGGGTCGGCTGGGAGAGATGCCTGCCGACCAGGGCT
TCCCGGCCTACCTCAGCGCCAAGCTGGCCTCCTTCTACGAGCGAGCCGGCAAGATCCAGGCTCTGGGCTCGCCCG
AGCGCGAGGGCAGCGTCAGCATCGTCGGCGCCGTCAGCCCCCCCGGCGGCGACTTCTCGGACCCGGTCACCAGCT
CGACGCTCAGCATCGTCCAGGTCTTTTGGGGCCTCGACAAGAAGCTCGCCCAGCGGAAGCACTTCCCGTCGATCA
ACACGAGCCTGTCGTACAGCAAGTACACGACGATCCTGGACAGGTACTACGAGAAGGAGTACCCCGACTTCCCCA
AGCTGCGCGACCGGATCAAGCAGCTGCTGTCGGACTCGGAGGAGCTGGACCAGGTGGTGCAGCTGGTGGGCAAGA
GCGCGCTCTCGGACCCCGACAAGATCACGCTCGACATCGCCGGGCTGATCAAGGAGGACTTTTTGCAGCAGAACG
GCTACTCGGACTACGACCAGTTCTGTCCGATCTGGAAGACGGAGTGGATGATGAAGCTCATGGTCGGCTTCCACG
ACGAATCGCAAAAGGCCATCGCCCAGGGCCAGAGCTGGGCCAAGGTGCGCGAGGCCACGAGCGACCTGCAAGCCA
AGCTGAGGCAGCTCAAGTTTGAGCTGCCGACGGACGGCGAGGAGGCCGTCACCAAGAAGGTTCGTACGAGGACTC
CCTTTCGTGGACGCCATCCGCTGACCCGGGCCGCAGTACGAGAGCATCCACCAGCAGATGATGGACAAGTTTGCG
TCGGTCATGGACGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail