Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6430
Gene name
LocationContig_33:49645..51337
Strand-
Gene length (bp)1692
Transcript length (bp)1692
Coding sequence length (bp)1692
Protein length (aa) 564

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 67 89 22
2 114 136 22
3 160 182 22
4 202 224 22
5 289 311 22
6 347 369 22
7 475 494 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6430
MDLIPASSTTSSPLDECQSRCYPQRHLFRRSREARLQEDIQSFFERSDHRQALPSFDEAAGTRRSCLIAVILGAT
LALVCMTLAVYVLVTEGAMFLSLRLAILEQEILSLSLNLVLTFCIDGMMFVHSVSLRWALYYENRLQYNTNIRLL
TSSRTSGPNRWYINMASLFFLILSYGTSSIMLPADPWENNWFSGPRICLNAIALSGLSVALAGQATIALWCLMLG
RDLIPTWGSNPFNTALAAMEKGHITRRPGRCLLSVHQRYHQQDRKVYPTLKQGNMLQAQPVVRYILALVWALAVL
ALAWPITVMILCRALDDDDCWRFSFQWQGAVHCDKNFVNLNFRVSQGFVEYFGVKIMWFTISLLGLVFVCGVQAL
QTLGLHCVELLVNISRDEAAWRRAYSETRRQAPGLQISTDPLRAAILSWENAVLFFSKALLHWAIAQGMPISISK
TLPDIPSEHPVGVDCVQFTIIYPRLFLYAVLALLLAAFATYLALKRPRGCQPATMGHLQTIADLIDDWETDEKGR
MWWGDKTGASGTDTGSRYAGMSHDSTLLSAIRTDAVYC*
Coding >Hirsu2|6430
ATGGATCTCATCCCGGCTTCCAGCACGACATCAAGTCCACTCGATGAATGCCAGTCAAGATGTTATCCGCAGCGG
CATCTCTTTCGCCGGAGCCGAGAGGCACGCTTACAAGAGGATATACAATCGTTCTTCGAGCGCAGCGACCACAGA
CAAGCCTTGCCGAGTTTCGACGAGGCGGCCGGTACTAGAAGGAGTTGCCTCATCGCCGTGATTCTGGGCGCAACT
CTTGCTCTCGTCTGCATGACTCTGGCTGTCTACGTTCTCGTCACGGAAGGGGCGATGTTCCTCTCCCTGCGTCTG
GCTATTCTCGAGCAAGAAATTCTCTCCCTTTCTCTCAACCTCGTTCTCACGTTCTGCATTGATGGCATGATGTTT
GTACACTCCGTCTCGCTACGCTGGGCATTGTACTACGAGAATCGTCTCCAGTATAATACCAACATCCGTCTCCTC
ACAAGCTCGAGGACAAGTGGCCCCAACCGGTGGTATATCAACATGGCGTCGCTCTTCTTCCTGATCCTATCGTAT
GGCACCTCGTCTATTATGCTTCCGGCTGATCCTTGGGAGAATAACTGGTTTTCTGGTCCTCGCATTTGCCTCAAT
GCCATCGCTCTATCGGGATTGAGCGTGGCGCTCGCAGGCCAGGCTACTATTGCGCTATGGTGTTTGATGCTCGGA
CGCGACTTGATACCGACCTGGGGTTCAAATCCATTTAATACGGCCCTGGCCGCCATGGAAAAAGGCCATATAACT
CGCAGGCCGGGAAGATGTTTGCTATCAGTCCACCAAAGGTACCACCAGCAAGATCGAAAGGTTTACCCGACCCTG
AAGCAGGGGAATATGCTTCAGGCACAGCCTGTGGTACGATATATCCTGGCCCTTGTATGGGCGCTCGCCGTTCTC
GCACTCGCTTGGCCGATCACCGTCATGATACTTTGCAGAGCTTTGGACGATGATGACTGCTGGAGATTCAGTTTT
CAGTGGCAGGGTGCTGTGCATTGCGATAAGAACTTTGTCAATTTGAATTTTCGGGTAAGCCAGGGCTTCGTCGAA
TACTTCGGAGTCAAGATAATGTGGTTCACGATAAGTCTACTTGGCCTTGTCTTTGTCTGCGGGGTCCAAGCCCTG
CAGACTCTTGGTCTGCATTGTGTGGAGTTGCTCGTCAATATATCGAGAGACGAAGCAGCTTGGCGACGAGCATAT
AGTGAAACGAGAAGACAAGCCCCAGGGTTACAGATATCTACGGATCCCTTACGAGCGGCTATTTTAAGCTGGGAA
AACGCTGTCCTGTTTTTCTCCAAGGCGTTGCTACACTGGGCTATCGCGCAGGGGATGCCGATTTCAATATCGAAA
ACTTTGCCTGACATACCGTCTGAACACCCGGTCGGCGTCGACTGCGTCCAATTCACCATTATATACCCCCGGCTT
TTTCTATACGCTGTGCTAGCCCTCCTTTTGGCCGCCTTTGCAACCTATCTAGCCCTCAAACGACCTCGAGGCTGT
CAGCCTGCCACTATGGGACACCTACAAACGATCGCAGACCTGATCGACGACTGGGAGACGGACGAAAAGGGCCGG
ATGTGGTGGGGGGATAAGACAGGAGCCTCCGGCACTGATACTGGGTCCCGTTACGCCGGGATGAGCCATGACAGC
ACGCTGCTTTCTGCGATTCGTACGGACGCTGTATATTGTTGA
Transcript >Hirsu2|6430
ATGGATCTCATCCCGGCTTCCAGCACGACATCAAGTCCACTCGATGAATGCCAGTCAAGATGTTATCCGCAGCGG
CATCTCTTTCGCCGGAGCCGAGAGGCACGCTTACAAGAGGATATACAATCGTTCTTCGAGCGCAGCGACCACAGA
CAAGCCTTGCCGAGTTTCGACGAGGCGGCCGGTACTAGAAGGAGTTGCCTCATCGCCGTGATTCTGGGCGCAACT
CTTGCTCTCGTCTGCATGACTCTGGCTGTCTACGTTCTCGTCACGGAAGGGGCGATGTTCCTCTCCCTGCGTCTG
GCTATTCTCGAGCAAGAAATTCTCTCCCTTTCTCTCAACCTCGTTCTCACGTTCTGCATTGATGGCATGATGTTT
GTACACTCCGTCTCGCTACGCTGGGCATTGTACTACGAGAATCGTCTCCAGTATAATACCAACATCCGTCTCCTC
ACAAGCTCGAGGACAAGTGGCCCCAACCGGTGGTATATCAACATGGCGTCGCTCTTCTTCCTGATCCTATCGTAT
GGCACCTCGTCTATTATGCTTCCGGCTGATCCTTGGGAGAATAACTGGTTTTCTGGTCCTCGCATTTGCCTCAAT
GCCATCGCTCTATCGGGATTGAGCGTGGCGCTCGCAGGCCAGGCTACTATTGCGCTATGGTGTTTGATGCTCGGA
CGCGACTTGATACCGACCTGGGGTTCAAATCCATTTAATACGGCCCTGGCCGCCATGGAAAAAGGCCATATAACT
CGCAGGCCGGGAAGATGTTTGCTATCAGTCCACCAAAGGTACCACCAGCAAGATCGAAAGGTTTACCCGACCCTG
AAGCAGGGGAATATGCTTCAGGCACAGCCTGTGGTACGATATATCCTGGCCCTTGTATGGGCGCTCGCCGTTCTC
GCACTCGCTTGGCCGATCACCGTCATGATACTTTGCAGAGCTTTGGACGATGATGACTGCTGGAGATTCAGTTTT
CAGTGGCAGGGTGCTGTGCATTGCGATAAGAACTTTGTCAATTTGAATTTTCGGGTAAGCCAGGGCTTCGTCGAA
TACTTCGGAGTCAAGATAATGTGGTTCACGATAAGTCTACTTGGCCTTGTCTTTGTCTGCGGGGTCCAAGCCCTG
CAGACTCTTGGTCTGCATTGTGTGGAGTTGCTCGTCAATATATCGAGAGACGAAGCAGCTTGGCGACGAGCATAT
AGTGAAACGAGAAGACAAGCCCCAGGGTTACAGATATCTACGGATCCCTTACGAGCGGCTATTTTAAGCTGGGAA
AACGCTGTCCTGTTTTTCTCCAAGGCGTTGCTACACTGGGCTATCGCGCAGGGGATGCCGATTTCAATATCGAAA
ACTTTGCCTGACATACCGTCTGAACACCCGGTCGGCGTCGACTGCGTCCAATTCACCATTATATACCCCCGGCTT
TTTCTATACGCTGTGCTAGCCCTCCTTTTGGCCGCCTTTGCAACCTATCTAGCCCTCAAACGACCTCGAGGCTGT
CAGCCTGCCACTATGGGACACCTACAAACGATCGCAGACCTGATCGACGACTGGGAGACGGACGAAAAGGGCCGG
ATGTGGTGGGGGGATAAGACAGGAGCCTCCGGCACTGATACTGGGTCCCGTTACGCCGGGATGAGCCATGACAGC
ACGCTGCTTTCTGCGATTCGTACGGACGCTGTATATTGTTGA
Gene >Hirsu2|6430
ATGGATCTCATCCCGGCTTCCAGCACGACATCAAGTCCACTCGATGAATGCCAGTCAAGATGTTATCCGCAGCGG
CATCTCTTTCGCCGGAGCCGAGAGGCACGCTTACAAGAGGATATACAATCGTTCTTCGAGCGCAGCGACCACAGA
CAAGCCTTGCCGAGTTTCGACGAGGCGGCCGGTACTAGAAGGAGTTGCCTCATCGCCGTGATTCTGGGCGCAACT
CTTGCTCTCGTCTGCATGACTCTGGCTGTCTACGTTCTCGTCACGGAAGGGGCGATGTTCCTCTCCCTGCGTCTG
GCTATTCTCGAGCAAGAAATTCTCTCCCTTTCTCTCAACCTCGTTCTCACGTTCTGCATTGATGGCATGATGTTT
GTACACTCCGTCTCGCTACGCTGGGCATTGTACTACGAGAATCGTCTCCAGTATAATACCAACATCCGTCTCCTC
ACAAGCTCGAGGACAAGTGGCCCCAACCGGTGGTATATCAACATGGCGTCGCTCTTCTTCCTGATCCTATCGTAT
GGCACCTCGTCTATTATGCTTCCGGCTGATCCTTGGGAGAATAACTGGTTTTCTGGTCCTCGCATTTGCCTCAAT
GCCATCGCTCTATCGGGATTGAGCGTGGCGCTCGCAGGCCAGGCTACTATTGCGCTATGGTGTTTGATGCTCGGA
CGCGACTTGATACCGACCTGGGGTTCAAATCCATTTAATACGGCCCTGGCCGCCATGGAAAAAGGCCATATAACT
CGCAGGCCGGGAAGATGTTTGCTATCAGTCCACCAAAGGTACCACCAGCAAGATCGAAAGGTTTACCCGACCCTG
AAGCAGGGGAATATGCTTCAGGCACAGCCTGTGGTACGATATATCCTGGCCCTTGTATGGGCGCTCGCCGTTCTC
GCACTCGCTTGGCCGATCACCGTCATGATACTTTGCAGAGCTTTGGACGATGATGACTGCTGGAGATTCAGTTTT
CAGTGGCAGGGTGCTGTGCATTGCGATAAGAACTTTGTCAATTTGAATTTTCGGGTAAGCCAGGGCTTCGTCGAA
TACTTCGGAGTCAAGATAATGTGGTTCACGATAAGTCTACTTGGCCTTGTCTTTGTCTGCGGGGTCCAAGCCCTG
CAGACTCTTGGTCTGCATTGTGTGGAGTTGCTCGTCAATATATCGAGAGACGAAGCAGCTTGGCGACGAGCATAT
AGTGAAACGAGAAGACAAGCCCCAGGGTTACAGATATCTACGGATCCCTTACGAGCGGCTATTTTAAGCTGGGAA
AACGCTGTCCTGTTTTTCTCCAAGGCGTTGCTACACTGGGCTATCGCGCAGGGGATGCCGATTTCAATATCGAAA
ACTTTGCCTGACATACCGTCTGAACACCCGGTCGGCGTCGACTGCGTCCAATTCACCATTATATACCCCCGGCTT
TTTCTATACGCTGTGCTAGCCCTCCTTTTGGCCGCCTTTGCAACCTATCTAGCCCTCAAACGACCTCGAGGCTGT
CAGCCTGCCACTATGGGACACCTACAAACGATCGCAGACCTGATCGACGACTGGGAGACGGACGAAAAGGGCCGG
ATGTGGTGGGGGGATAAGACAGGAGCCTCCGGCACTGATACTGGGTCCCGTTACGCCGGGATGAGCCATGACAGC
ACGCTGCTTTCTGCGATTCGTACGGACGCTGTATATTGTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail