Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|643
Gene name
LocationContig_113:1211..2976
Strand-
Gene length (bp)1765
Transcript length (bp)1698
Coding sequence length (bp)1698
Protein length (aa) 566

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.6E-35 92 493

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 38 561 2.0E-58
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 45 548 7.0E-55
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 14 559 4.0E-34
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 25 538 9.0E-34
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 106 403 8.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 38 561 2.0E-58
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 45 548 7.0E-55
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 14 559 4.0E-34
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 25 538 9.0E-34
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 106 403 8.0E-19
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 143 507 9.0E-19
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 143 507 9.0E-19
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 67 485 1.0E-18
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 121 388 1.0E-17
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 86 490 9.0E-15
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 107 422 2.0E-14
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 107 422 2.0E-14
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 141 459 2.0E-14
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 105 343 6.0E-13
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 105 522 2.0E-12
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 4 405 4.0E-12
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 109 397 3.0E-11
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 109 397 3.0E-11
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 121 417 1.0E-10
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 145 419 2.0E-10
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 145 419 2.0E-10
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 87 450 4.0E-10
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 106 296 5.0E-10
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 106 296 5.0E-10
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 121 382 5.0E-10
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 128 373 3.0E-08
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 106 533 4.0E-08
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 143 389 9.0E-08
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 106 342 2.0E-07
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 106 513 2.0E-07
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 106 533 3.0E-07
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 106 509 3.0E-07
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 72 367 4.0E-07
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 106 407 7.0E-07
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 106 288 1.0E-06
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 106 288 1.0E-06
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 106 288 1.0E-06
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 106 288 1.0E-06
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 106 513 1.0E-06
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 140 274 2.0E-06
sp|P37594|SMVA_SALTY Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=smvA PE=3 SV=2 105 299 4.0E-06
sp|D0ZXQ3|SMVA_SALT1 Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=smvA PE=1 SV=1 105 299 4.0E-06
sp|P36890|TCR_STAHY Tetracycline resistance protein OS=Staphylococcus hyicus GN=tet PE=3 SV=1 106 242 8.0E-06
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 106 407 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 87 109 22
2 150 172 22
3 177 199 22
4 211 233 22
5 243 265 22
6 277 294 17
7 309 331 22
8 352 374 22
9 384 406 22
10 411 430 19
11 440 462 22
12 482 504 22
13 519 541 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|643
MTASAPLVVATSPLASEDKAVVAPEDKAVVAPDASKRSSGVDGPNQQAYLESSGEESGADGSGPMNVKRLGRERP
AALSSGLVEAGFVFTVVLSMMMSEYFIGGFNIILPPVADALAIPPSARTWPAGVTNLTTAALLQPFARMCDLYGA
RVVFICGHAWLLVWSLITGFSVNSTMLIVCRAMQGIGAAAFLPAGLALLSQTYRPGPRKNFVFSVYGAFACIGFY
FGIFMGAVAAQYLNWRWYFWIGTILGLCLVLSGFLTVPRGLGDVDPDVRMDWWGVVTIVPGLVLVVFAFTDGGHA
PDGWRTPYVYVTLIIGILFLVAAVYVQGWVSSQPLLPPEIFKLKYMKRLMGALFCSYGVFGLFLFYASFYIETVL
HTSPILSAAWFTPLAVGGMFLAIGGGLVLHIVSNRILMLISGLGFLLSTLLFALIPSSGKSTSFIYWAYIFPAML
GGTIGVDITFNVTNVFITTAMPRRHQAAASGLINSLLYLGIAFWLGIAELAISATQQSKGADSLDPRAQYQIGFW
TGVGLAAVSLCLTVTVRMGQAEATMTADERAELERETNGS*
Coding >Hirsu2|643
ATGACGGCGTCGGCGCCCCTGGTTGTGGCGACGAGCCCTCTCGCCTCGGAAGACAAGGCCGTCGTCGCCCCGGAA
GACAAGGCCGTCGTCGCCCCGGACGCTTCGAAGCGTTCGTCCGGCGTGGACGGGCCAAACCAGCAGGCCTACTTG
GAGTCGTCGGGCGAGGAGAGCGGCGCCGACGGCTCGGGGCCGATGAACGTCAAGCGCCTGGGCCGCGAACGGCCA
GCGGCCCTGTCCAGCGGGCTGGTCGAGGCCGGCTTCGTCTTCACCGTCGTCCTTTCCATGATGATGAGCGAGTAC
TTCATCGGCGGCTTCAACATCATCCTGCCGCCCGTCGCCGACGCCCTGGCCATCCCCCCTTCGGCCCGCACCTGG
CCCGCCGGCGTGACCAACCTCACGACGGCCGCCCTGCTGCAGCCGTTTGCCCGGATGTGCGACCTGTACGGCGCC
CGCGTCGTCTTCATCTGCGGCCACGCCTGGCTGCTCGTCTGGTCCCTCATCACCGGCTTCAGCGTCAACTCGACC
ATGCTCATCGTCTGCCGCGCCATGCAGGGCATCGGCGCCGCCGCCTTTTTGCCCGCCGGCCTCGCCCTGCTCAGC
CAGACGTACCGGCCGGGCCCGCGCAAGAACTTCGTCTTCTCCGTCTACGGCGCCTTCGCCTGCATCGGCTTCTAC
TTTGGCATCTTCATGGGCGCCGTTGCCGCCCAGTACCTCAACTGGAGGTGGTACTTCTGGATCGGCACCATCCTC
GGCCTCTGCCTCGTCCTCTCCGGCTTCCTCACCGTGCCCCGCGGCCTCGGCGACGTCGACCCGGACGTCCGTATG
GACTGGTGGGGCGTCGTCACCATCGTCCCGGGCCTCGTCCTCGTCGTCTTCGCCTTCACGGACGGCGGCCACGCC
CCCGACGGCTGGCGCACCCCCTACGTCTACGTCACCCTCATCATCGGCATCCTCTTTCTCGTTGCTGCCGTCTAC
GTCCAGGGCTGGGTCTCGTCCCAGCCGCTGCTCCCGCCGGAGATCTTCAAGCTCAAGTACATGAAGCGCCTCATG
GGCGCACTCTTCTGCTCCTACGGCGTCTTTGGCCTGTTTCTGTTTTACGCCAGCTTCTACATCGAAACCGTGCTG
CATACGTCGCCCATCTTGTCGGCGGCCTGGTTCACCCCTCTGGCCGTCGGCGGCATGTTCCTGGCCATCGGCGGG
GGGCTGGTGCTGCACATCGTCTCGAACCGCATCCTCATGCTCATCTCGGGCCTGGGCTTCCTGCTCTCGACGTTG
CTGTTCGCCCTCATCCCCAGCAGCGGCAAGTCGACGAGCTTCATCTACTGGGCGTACATCTTCCCCGCCATGCTC
GGCGGCACCATCGGCGTCGACATCACCTTCAACGTGACCAACGTCTTCATCACGACGGCCATGCCGCGCCGTCAC
CAGGCGGCGGCCAGCGGCCTCATCAACAGCCTGCTGTACCTCGGCATCGCCTTCTGGCTGGGCATCGCCGAGCTG
GCCATCTCGGCCACGCAGCAGAGCAAGGGCGCCGACAGCCTGGACCCTCGGGCCCAATATCAGATCGGCTTCTGG
ACGGGCGTGGGCCTCGCGGCCGTCTCCCTGTGCCTGACGGTGACAGTCAGGATGGGGCAGGCCGAGGCCACCATG
ACGGCCGATGAGCGGGCCGAGCTGGAACGCGAGACGAACGGGTCGTGA
Transcript >Hirsu2|643
ATGACGGCGTCGGCGCCCCTGGTTGTGGCGACGAGCCCTCTCGCCTCGGAAGACAAGGCCGTCGTCGCCCCGGAA
GACAAGGCCGTCGTCGCCCCGGACGCTTCGAAGCGTTCGTCCGGCGTGGACGGGCCAAACCAGCAGGCCTACTTG
GAGTCGTCGGGCGAGGAGAGCGGCGCCGACGGCTCGGGGCCGATGAACGTCAAGCGCCTGGGCCGCGAACGGCCA
GCGGCCCTGTCCAGCGGGCTGGTCGAGGCCGGCTTCGTCTTCACCGTCGTCCTTTCCATGATGATGAGCGAGTAC
TTCATCGGCGGCTTCAACATCATCCTGCCGCCCGTCGCCGACGCCCTGGCCATCCCCCCTTCGGCCCGCACCTGG
CCCGCCGGCGTGACCAACCTCACGACGGCCGCCCTGCTGCAGCCGTTTGCCCGGATGTGCGACCTGTACGGCGCC
CGCGTCGTCTTCATCTGCGGCCACGCCTGGCTGCTCGTCTGGTCCCTCATCACCGGCTTCAGCGTCAACTCGACC
ATGCTCATCGTCTGCCGCGCCATGCAGGGCATCGGCGCCGCCGCCTTTTTGCCCGCCGGCCTCGCCCTGCTCAGC
CAGACGTACCGGCCGGGCCCGCGCAAGAACTTCGTCTTCTCCGTCTACGGCGCCTTCGCCTGCATCGGCTTCTAC
TTTGGCATCTTCATGGGCGCCGTTGCCGCCCAGTACCTCAACTGGAGGTGGTACTTCTGGATCGGCACCATCCTC
GGCCTCTGCCTCGTCCTCTCCGGCTTCCTCACCGTGCCCCGCGGCCTCGGCGACGTCGACCCGGACGTCCGTATG
GACTGGTGGGGCGTCGTCACCATCGTCCCGGGCCTCGTCCTCGTCGTCTTCGCCTTCACGGACGGCGGCCACGCC
CCCGACGGCTGGCGCACCCCCTACGTCTACGTCACCCTCATCATCGGCATCCTCTTTCTCGTTGCTGCCGTCTAC
GTCCAGGGCTGGGTCTCGTCCCAGCCGCTGCTCCCGCCGGAGATCTTCAAGCTCAAGTACATGAAGCGCCTCATG
GGCGCACTCTTCTGCTCCTACGGCGTCTTTGGCCTGTTTCTGTTTTACGCCAGCTTCTACATCGAAACCGTGCTG
CATACGTCGCCCATCTTGTCGGCGGCCTGGTTCACCCCTCTGGCCGTCGGCGGCATGTTCCTGGCCATCGGCGGG
GGGCTGGTGCTGCACATCGTCTCGAACCGCATCCTCATGCTCATCTCGGGCCTGGGCTTCCTGCTCTCGACGTTG
CTGTTCGCCCTCATCCCCAGCAGCGGCAAGTCGACGAGCTTCATCTACTGGGCGTACATCTTCCCCGCCATGCTC
GGCGGCACCATCGGCGTCGACATCACCTTCAACGTGACCAACGTCTTCATCACGACGGCCATGCCGCGCCGTCAC
CAGGCGGCGGCCAGCGGCCTCATCAACAGCCTGCTGTACCTCGGCATCGCCTTCTGGCTGGGCATCGCCGAGCTG
GCCATCTCGGCCACGCAGCAGAGCAAGGGCGCCGACAGCCTGGACCCTCGGGCCCAATATCAGATCGGCTTCTGG
ACGGGCGTGGGCCTCGCGGCCGTCTCCCTGTGCCTGACGGTGACAGTCAGGATGGGGCAGGCCGAGGCCACCATG
ACGGCCGATGAGCGGGCCGAGCTGGAACGCGAGACGAACGGGTCGTGA
Gene >Hirsu2|643
ATGACGGCGTCGGCGCCCCTGGTTGTGGCGACGAGCCCTCTCGCCTCGGAAGACAAGGCCGTCGTCGCCCCGGAA
GACAAGGCCGTCGTCGCCCCGGACGCTTCGAAGCGTTCGTCCGGCGTGGACGGGCCAAACCAGCAGGCCTACTTG
GAGTCGTCGGGCGAGGAGAGCGGCGCCGACGGCTCGGGGCCGATGAACGTCAAGCGCCTGGGCCGCGAACGGCCA
GCGGCCCTGTCCAGCGGGCTGGTCGAGGCCGGCTTCGTCTTCACCGTCGTCCTTTCCATGATGATGAGCGAGTAC
TTCATCGGCGGCTTCAACATCATCCTGCCGCCCGTCGCCGACGCCCTGGCCATCCCCCCTTCGGCCCGCACCTGG
CCCGCCGGCGTGACCAACCTCACGACGGCCGCCCTGCTGCAGCCGTTTGCCCGGATGTGCGACCTGTACGGCGCC
CGCGTCGTCTTCATCTGCGGCCACGCCTGGCTGCTCGTCTGGTCCCTCATCACCGGCTTCAGCGTCAACTCGACC
ATGCTCATCGTCTGCCGCGCCATGCAGGGCATCGGCGCCGCCGCCTTTTTGCCCGCCGGCCTCGCCCTGCTCAGC
CAGACGTACCGGCCGGGCCCGCGCAAGAACTTCGTCTTCTCCGTCTACGGCGCCTTCGCCTGCATCGGCTTCTAC
TTTGGCATCTTCATGGGCGCCGTTGCCGCCCAGTACCTCAACTGGAGGTGGTACTTCTGGATCGGCACCATCCTC
GGCCTCTGCCTCGTCCTCTCCGGCTTCCTCACCGTGCCCCGCGGCCTCGGCGACGTCGACCCGGACGTCCGTATG
GACTGGTGGGGCGTCGTCACCATCGTCCCGGGCCTCGTCCTCGTCGTCTTCGCCTTCACGGACGGCGGCCACGCC
CCCGACGGCTGGCGCACCCCCTACGTCTACGTCACCCTCATCATCGGCATCCTCTTTCTCGTTGCTGCCGTCTAC
GTCCAGGGCTGGGTCTCGTCCCAGCCGCTGCTCCCGCCGGAGATCTTCAAGCTCAAGTACATGAAGCGCCTCATG
GGCGCACTCTTCTGCTCCTACGGCGTCTTTGGCCTGTTTCTGTTTTACGCCAGCTTCTAGTAGGTCCATGCCTTG
CCCGCGTGTCGAGAGATTACATGGACGGATTGTGCTAACTCGCCCGCGCAGCATCGAAACCGTGCTGCATACGTC
GCCCATCTTGTCGGCGGCCTGGTTCACCCCTCTGGCCGTCGGCGGCATGTTCCTGGCCATCGGCGGGGGGCTGGT
GCTGCACATCGTCTCGAACCGCATCCTCATGCTCATCTCGGGCCTGGGCTTCCTGCTCTCGACGTTGCTGTTCGC
CCTCATCCCCAGCAGCGGCAAGTCGACGAGCTTCATCTACTGGGCGTACATCTTCCCCGCCATGCTCGGCGGCAC
CATCGGCGTCGACATCACCTTCAACGTGACCAACGTCTTCATCACGACGGCCATGCCGCGCCGTCACCAGGCGGC
GGCCAGCGGCCTCATCAACAGCCTGCTGTACCTCGGCATCGCCTTCTGGCTGGGCATCGCCGAGCTGGCCATCTC
GGCCACGCAGCAGAGCAAGGGCGCCGACAGCCTGGACCCTCGGGCCCAATATCAGATCGGCTTCTGGACGGGCGT
GGGCCTCGCGGCCGTCTCCCTGTGCCTGACGGTGACAGTCAGGATGGGGCAGGCCGAGGCCACCATGACGGCCGA
TGAGCGGGCCGAGCTGGAACGCGAGACGAACGGGTCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail